SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302876022|ref|YP_003844655.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876022|ref|YP_003844655.1|
Domain Number 1 Region: 288-633
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.81e-111
Family beta-glycanases 0.000000029
Further Details:      
 
Domain Number 2 Region: 2-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-48
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 188-291
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 6.91e-17
Family beta-Galactosidase/glucuronidase domain 0.0029
Further Details:      
 
Domain Number 4 Region: 736-818
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000000691
Family beta-Galactosidase/glucuronidase domain 0.0045
Further Details:      
 
Domain Number 5 Region: 634-726
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000388
Family beta-Galactosidase/glucuronidase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302876022|ref|YP_003844655.1|
Sequence length 819
Comment glycoside hydrolase family 2 [Clostridium cellulovorans 743B]
Sequence
MKSINLSGSWNLKCKDKDIDISAVVPGSVYKALIDENIIEDPFYRDNEKEAYKYSEYDFI
YKRSFVIDQELLAQEVVVLKCDGLDTLAEIKVNNKLIAETTNMHRTYEFHVKDVLVEGEN
EIEIIFSSPLKYIREKQKEARLWGVGDAVDGYSHIRKAHYMFGWDWGPQLPDMGIWREIS
IYSYSTAKFSDIYMTQIHHENKVTIDAKVAYEILKEDENLNIVVEVKEPNGTHKNYKKVV
ANSDESILIDIENPELWWPRGYGEQPLYEIEFSLFSGQTLLDKKDYKIGLRTITIKQEKD
QYGESFEFNINGISIFAMGANYIPEDNILGRCDKEKTRKLIEDCIEANFNCIRVWGGGIY
PEDYFFDLCDEYGLIVWQDLMYACSVYKVDDEFKEDCVKEAEDNVRRIRHHASLGLWCGN
NEIESAWIDWGWNPKSKFKTDYVKLFEIALPEVVKKVDPNTFYWRSSPSSGGSFDDPSDD
NRGDKHYWDVWHGLKPFEDFRKFYFRFASEFGFQSFPCLKTVETFTKEEDRNIFSYVMES
HQKNGAANGKILYYLAQNYKYPKDFDALLYVSQLLQGEAMKYAVEHFRRNRGRCMGAIYW
QLNDCWPVASWSSIDSLGTWKALHYFAKRFFNPVLASVEDTAESYKVYVTNDTLEKVQGT
VDLTLRNNVKGVLLEKSIDVVLEPLSAQMITEIDITEFIKDNLDARNTYLHYTFKNNCKI
ISEGVILGEKAKHFELADPKVEAKVIDDKDKFIVKLKAENLAKYVELSIADQGRFEDNYF
DLAPGVEKEVIISKNTLRKDFTLEELEEQLKIRSLVNSY
Download sequence
Identical sequences D9SUD6
gi|302876022|ref|YP_003844655.1| WP_010073275.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]