SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302876296|ref|YP_003844929.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876296|ref|YP_003844929.1|
Domain Number 1 Region: 262-429,472-480,509-626
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.88e-49
Family beta-glycanases 0.016
Further Details:      
 
Domain Number 2 Region: 4-162
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.36e-26
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.038
Further Details:      
 
Domain Number 3 Region: 165-265
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000118
Family beta-Galactosidase/glucuronidase domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302876296|ref|YP_003844929.1|
Sequence length 938
Comment glycoside hydrolase family 2 [Clostridium cellulovorans 743B]
Sequence
MYKTIDLSGIWNFQLDKEKQGINKPFNDTINLPGTTAYFKKGEKNENVEIGFLTEEYKFE
GHAWFSKTIEILEDNNAKNYFLYLERTRVTTVWIDGNKVGTQNSLSTPHIYDVTNYLSSG
KHEITILVDNTDYPTRGGHLTSPDTQSNWNGITGKIELQVFDKTYLTDVQVYSNIKDKTV
EIKGKVAGADNGTISVSAVSFNSEKEHKVGEKEFKFTSKEIDITYSLGEEALLWSEHEPS
LYKLKVNLIIDDCIVDTNEITFGLREFKSEGDKFTINGDKTFLRGKHDGLIFPLTGFAPT
TVEEWLEVLNISKSYGINHYRFHTCCPPEAAFVAADILGIYMQPELPFWGTITDEKDENH
NQAEQDYLVSEGFSMLKTFGNHPSFVMMSLGNELWGSKERLDVILKDYKELDNRHLYTQG
SNNFQFCPVILENDDFFSGVRFSRDRLFRGSYAMCDAPLGHVQTDIPSTMKDYDENIFPT
ALKDIENSKVNADGTIEIQFGTGTKKVKATDFSEDMVPNVPVVSHEIGQYATFPNFDEIK
KYTGPLKARNFETFKQRLEEKGLEDLAEKYFKASGTLAMACYKEELEAAFRSKKLAGFQL
LDLQDFSGQGTALVGVLDAFMDSKGLISPEEWRSFCSDAVLMARFDKYNYLAEENFKAHI
ELCYYKNIPLKNLKLLWELKNNNTIYEKGEVELSNIEAANYIDIADISLKMPKIDLMEKL
TLSLKVDGMDIEKTYDLWVYPNEVTIEKEGLNIVHSLSKEAISLLEKGERVVLFPKLETL
KNSIEGFYCTDFWCYPMFRSISESVKREVPVGTMGLLIQNNHPIFKDFPCEEYSTYQWWN
IVSNSRSIILDNTSKDFRPIVQTIDNFERNHKLGLIFECKVLSGKLLVCTCDFEKVIDMP
EAKQFLFSVLNYVRSNEFNPKVEIGVSELEGILLASQK
Download sequence
Identical sequences A0A173MZW3 D9SVV4
WP_010073567.1.47838 gi|302876296|ref|YP_003844929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]