SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302876463|ref|YP_003845096.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876463|ref|YP_003845096.1|
Domain Number 1 Region: 53-365
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.84e-74
Family beta-glycanases 0.00000000551
Further Details:      
 
Domain Number 2 Region: 378-556
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.86e-67
Family Family 17 carbohydrate binding module, CBM17 0.0000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302876463|ref|YP_003845096.1|
Sequence length 557
Comment cellulase [Clostridium cellulovorans 743B]
Sequence
MFNNVKKKILSIVAAGAMLMALVPNINVAAETTYSNLTGNANVKKPSVGGKLQLLNKNGI
KTLCDKDGNPIQLRGMSTHGLQWFPGVVNNNAFAALSNDWNSNVIRLAMYVAEGGYATNP
SVKQTVINGINYAIANDMYVIVDWHMMNPGDPNASVYSGAQSFFNDISTLYPNNKNIIYE
LCNEPNGENGGVTNDATGWAQVKSYATPIVQLLRNKGNENLIIVGNPFWSQRPDLAADNP
INDSNTMYSVHFYSGTNPISTVDTNRDNAMSNVRYALNHGAAVFATEWGTSLATGTTGPY
LAKADAWLDFLNGNNISWCNFSISNKDEKAAALNSLTSLDPGSDKLWADNELTTSGQYVR
ARIKGAYYATPVDPVTNQPTAPKDFSSGFWDFNDGTTQGFGVNPDSPITAINVENANNAL
KISNLNSKGSNDLSEGNFWANVRISADIWGQSINIYGDTKLTMDVIAPTPVNVSIAAIPQ
SSTHGWGNPTRAIRVWTNNFVAQTDGTYKATLTISTNDSPNFNTIATDAADSVVTNMILF
VGSNSDNISLDNIKFTK
Download sequence
Identical sequences D9SWQ0 P94622
WP_010073669.1.47838 gi|302876463|ref|YP_003845096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]