SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302876847|ref|YP_003845480.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876847|ref|YP_003845480.1|
Domain Number 1 Region: 541-644,674-873
Classification Level Classification E-value
Superfamily SGNH hydrolase 6.32e-71
Family Putative acetylxylan esterase-like 0.0059
Further Details:      
 
Domain Number 2 Region: 67-219
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-18
Family Family 27 carbohydrate binding module, CBM27 0.00099
Further Details:      
 
Domain Number 3 Region: 238-356
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000001
Family Family 6 carbohydrate binding module, CBM6 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302876847|ref|YP_003845480.1|
Sequence length 1235
Comment LPXTG-motif cell wall anchor domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MLKRLNMKKFASLLMAASLVTSLVSSPAVKTYAAESEKTLYTFEDNTTMGWDVLNTVANG
GAFDSSASAPVEYSQDLKQDGNSGALKINANFTGKTWDDASVIVNLGSSAKDFSSYDTLD
YDLFVQSDFTSKLTVATAGMDSSWAWKDDLFVANYGGIDVTTGEKITINGNDYNKIHITR
SKTSTLDSLTDKTFYRFIIKIAAVNTTYCGPIYLDNIALSKGGYIPGNTPSKTGKDDITV
EAENGVLTGLTVTPDSGASGGAYVNGLDSGTDRMDLTADIQVSGSYLIIMKYKTYGGAKI
NPVYLNGALLKDCSFPEAQSEWKNVILSPQYLSAGKNVFSLGNSWGWIAVDNVRFVGGDG
KQVGQVSLSSDTTSSQAYDIPVTFTAIADDAAQYRFLSRKVGGDWQEISPYSNKLSCIWV
PGAAGDYEVKVTARGTATTVDQQAEQIIKYTALPAYENKPLVNQVFGSGMVLQRDIENAL
WGWDKPNTNITVKVGTKTFTGITDSEGKWKISIGTYPAGGPYDISVSDGTTTTNMTDVLF
GDVWLCSGQSNMAFQLTGTLDSENEIKNSDYPNIRYYTVPVKTSYVPLSNIDNAQGWKVC
SPSTSGNLSAVAYFFARKLTTDLNVPIGVVFAAEGGTRAEQWTSYESLQNIPEYVAASNA
IKSCSTEIDATSSPNVLYNGMIAPVAPYGLKGVLWYQGESNWGDASYERLLPNLIADWRK
NFNVKDLPFILVQLPGFADLQSETNAVQPGNGLAEIRDAQLKTTLNDENVGLAVITDIGD
PNNLHPTNKQDVGFRTALSAEKKVYGKDIVYSGPIYKSMSIEGTSIKINFDSIGSGLMVG
SKEGLNPVQEVKDGKLTGFAIAGSDNVFYLADAVISGDSVIVSSSKVPDPKVVRFGWANS
PVTNLYNKEGLPASPFGTDMTYTRVAELTSIDNITKTVNVGQPYSLPSTVTAKYSDGTTK
AVAVTWTPASVDTSKAGIYTFKGTVKGYDKEVSLTLTVLGSLGLVIELDNDINKILQSLN
DSNIICIHINAKNNPVVSKDVFNALKGKKKIVTIFADNVTWEFNGEGIDISVANDIDFSL
KSVSSALQAKELAKAKAILGNDLSIVPFSFNHDGPLPSNARTSVFVGKNLAGKTVNVYRY
FEDKDSCEYIADSVVDANGYITINLNHCSDYFAVEKTSATIVPKTDAAEQPKTDAINLPQ
TGSAIDTSVLMTLGVLLFITGAAFFVLSRRKQNSK
Download sequence
Identical sequences D9SLS9
gi|302876847|ref|YP_003845480.1| WP_010074065.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]