SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302876902|ref|YP_003845535.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876902|ref|YP_003845535.1|
Domain Number 1 Region: 30-109
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 3.22e-18
Family Invasin/intimin cell-adhesion fragments 0.0052
Further Details:      
 
Domain Number 2 Region: 531-611
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 6.28e-18
Family Invasin/intimin cell-adhesion fragments 0.0054
Further Details:      
 
Domain Number 3 Region: 281-355
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 7.06e-18
Family Invasin/intimin cell-adhesion fragments 0.003
Further Details:      
 
Domain Number 4 Region: 363-440
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.1e-17
Family Invasin/intimin cell-adhesion fragments 0.0067
Further Details:      
 
Domain Number 5 Region: 197-278
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 5.89e-17
Family Invasin/intimin cell-adhesion fragments 0.003
Further Details:      
 
Domain Number 6 Region: 447-526
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 2.51e-16
Family Invasin/intimin cell-adhesion fragments 0.0059
Further Details:      
 
Domain Number 7 Region: 115-195
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000000000129
Family Invasin/intimin cell-adhesion fragments 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302876902|ref|YP_003845535.1|
Sequence length 613
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKVKKWKKVFVAILTFMIIFQNFGVSAVTTIPVTGVTLDKLSGTIPEGENLKLTAIVMPT
NATNKKVVWTSSDERIAKVDQTGQVTAVAPGSTRITATTEEGSKRVSSIITVSTKVKGIS
LNIAKAQISKGGYIFLKETVTPTNAANKKVTWTSSNTQVATVDATGKVIGIQPGVAIIKA
KTQDGGYEATSTITVIIPTTMIKLDKTAASITKGKSITLVATVGPNDATNKKVTWKSSNT
AIATVDATGKVTAISLGNAIITVTTENGGRIASCAVAVVPPIASVVSDRNTAEVDIGKTI
ALLATVYPTNAMNKNITWSSSNPSVATVDALGKVTAVSVGSATITVTTVDGGLKAQSVIK
VINPVTGVNISQSIDYIQENGTYQFLASVLPSNATKTSIKWSSSDEKIAKVDANGLVTAM
APGTCMIIATSEDGIRKAARVISVTPKVQGVKIDRTSVTMNKTENLQLKATVMPSSALNN
HVIWTSSNTSVATVDITGKVTAVSVGNATIIATTQEGGFVATSQITVVNSIRSILLDKTK
AAIKAGQDLALVLTITPIDATNKNIIWSSSNTNIAVVDSQGVVTGVSPGIATISAVAESN
SNKKVTCVVTVTN
Download sequence
Identical sequences D9SMB5
gi|302876902|ref|YP_003845535.1| WP_010074122.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]