SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302876972|ref|YP_003845605.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876972|ref|YP_003845605.1|
Domain Number 1 Region: 42-143,178-232
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000477
Family Pancreatic lipase, N-terminal domain 0.071
Further Details:      
 
Domain Number 2 Region: 393-475
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000000000118
Family Invasin/intimin cell-adhesion fragments 0.016
Further Details:      
 
Weak hits

Sequence:  gi|302876972|ref|YP_003845605.1|
Domain Number - Region: 318-398
Classification Level Classification E-value
Superfamily SurE-like 0.0288
Family SurE-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302876972|ref|YP_003845605.1|
Sequence length 477
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKKKCKMKGKYLALALSLSCIITPQLSYASEVDNTTMASNNGSFINLDWTKLSWDNLDWN
ELNYGIYWYGIGNKPYKFIPNETNPAFDPSKPTIIYIHGWQPNYSLIKHRESFYFYGENA
ADSWIKAGWNVGVFYWNQFSDELSVEDAESKIWSPTARNSMRWRKSDGSYDVSSSIKKSS
ADLLYEEYVKALSGYKGSSIRIVGHSLGSQMAIRLTKLISDNVDSGAIPPELLPSRVALL
DPYFSNLGKEYLNYRWTGEVARECVSSFINNKNIPFELYKSSALTSGLAGDDNDELKKMC
AYTELKPLFHAPIQQVEKHYDGKYTYFCSYRVSSPAEYVGTTPTGNVAASARTDTQRIAE
MMGKKYYWTQAADIFTEDVSDDTFSRSTRNISVSPVTGLNLNTYNANVKVGEYISLIPTI
APDNATNKIVLWQSYDDKVAKVCVNGQVKGENPGMVKIICNTADGKLQKVCNVNVIE
Download sequence
Identical sequences D9SMI5
gi|302876972|ref|YP_003845605.1| WP_010074196.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]