SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873060|ref|YP_003841693.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873060|ref|YP_003841693.1|
Domain Number 1 Region: 28-131
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000000248
Family Collagen-binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 279-382
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000124
Family Collagen-binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 405-513
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000144
Family Collagen-binding domain 0.0062
Further Details:      
 
Domain Number 4 Region: 154-264
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000222
Family Collagen-binding domain 0.0095
Further Details:      
 
Domain Number 5 Region: 531-637
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000235
Family Collagen-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302873060|ref|YP_003841693.1|
Sequence length 644
Comment peptidase domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MMKKVLSLIICLLIFTSTNFSKVVYSAELYEIESNNDFSTANIVALGDITQGQILAANDY
DFFKLQISYPQETNILLSNIPSGCDFDLYIYDSNGSSMASSTKGSNADDSVTQTLNVGTY
YIKVLRYSGSSSSFYKLSTLPIGTTPTIPSPDGNIYESEANNDFSNSNSIIFGSTIKGQI
LTSTDYDCFKLQLLYPRDTNILLNNIPSGCDFDLSLYDSNGFKVDSSINRSNVDESITKT
LAAGTYYIRIASATGNSDIYYNLSTSQTPPLAPSADGFVYENEANDDFSAANAIPFGSTV
KGNIAASSNVDYFKLQLSSTENIKILLSNISTGCDYDLVLFDFNNNYIASSKKGSNVDES
ITHSLAAGIYYIKISSYSGSSNNYYSLSTTLAGNAPMAPYPDGGLYEREPNDSSSTAYPI
EVGNSIKGQITSTSDNDLFKFQTYSTESLKIGLSDVPDDCNFDLYLYDSNMNRIDSSTNG
FGTVESIYKSLPAGTYYIKIISTLRSSTEYYNLSITDVIPPTSTFHGGDIYEFDDSFSLA
TDMGEGSFTISEPNLNVSNDMDYFKFNLIQRSDVRVVLTNPNYSSAKYRFDLYNSSYGNI
SYAYNVSEYTITLEPGTYYIKVHDNTAAPYTGLNYQLQMTATGL
Download sequence
Identical sequences D9SNQ8
WP_010075315.1.47838 gi|302873060|ref|YP_003841693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]