SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302873807|ref|YP_003842440.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873807|ref|YP_003842440.1|
Domain Number 1 Region: 155-264
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000785
Family Collagen-binding domain 0.0067
Further Details:      
 
Domain Number 2 Region: 572-676
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000034
Family Collagen-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 32-147
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000144
Family Collagen-binding domain 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|302873807|ref|YP_003842440.1|
Domain Number - Region: 299-379
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00458
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873807|ref|YP_003842440.1|
Sequence length 679
Comment peptidase domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MLRFKKSIACLITASTVMLSSAIPALATIGMTESTANDSVATATVIPSNFNLTQEIQGSI
ENPGDVDYYKFVPLNSAGYSISTLGSTDTFGYLYDSNMNILDVCDDEFNPNSDNLQLCYN
LTAGNTYYIKVSHKNTTDTGNYTLKIDPICNYYNKEIESNNSFETATSLSGVITNMPATI
GTAGDEDYYALTLPGGGTFSVETTGSTDTFGAIYDSNHNLISADDNNGEDNNMKIISPLA
GRQTYYVKVNHASPNGTGSYNLKISQTQSAYDLDGSDFSSAVDLTSATSNAVSHSGLGIN
YSEDIDFFKFTPRVDGIYTFKSSGLTNVDGTVLDNNHNILKSDKDSGADENFMIDVSLTA
NQTYYLMVSSYPGVTGSYSIDIAKGKCLNVPQYLQLPYDMLCWASSTSMAISYFNHDTID
RTLEIAQNRAKIDYASSESLYGPDYYKYPSVFNQPHELINCSEYIDPSITPNVRVRPYYL
EPQKAYSCGYTKAELIESIDKGYPILAKISNGHGGAHVIVLKGYMEDTNGVINTIYNDPL
DGQEHIIPDVSPLTCVTFYPASPLPTDNEPVNNTLSDALPLTNDQTVQGSIGQVGDVDFY
KFSFGNSANHQCIFETTGTTDTYGEVYDINGNLIASADNGGEGNNFKIQFTSPAYTQYYV
KVTHSSNGTGSYTLNYTYN
Download sequence
Identical sequences D9ST60
gi|302873807|ref|YP_003842440.1| WP_013291628.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]