SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302874168|ref|YP_003842801.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874168|ref|YP_003842801.1|
Domain Number 1 Region: 804-946
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.45e-29
Family Ricin B-like 0.0058
Further Details:      
 
Domain Number 2 Region: 953-1011
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000209
Family Type I dockerin domain 0.00048
Further Details:      
 
Domain Number 3 Region: 673-766
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000017
Family Family 6 carbohydrate binding module, CBM6 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302874168|ref|YP_003842801.1|
Sequence length 1013
Comment glycosyl hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MKIKRFFAMLISAVMMISMISFLPFEGKSGANKSGILGGIEALANQSLNITPLTAYAATT
SNLRRPVSSEQPMLIVHIDTWNYADPAKIIDLIPEDILPYVVFNISLSINWDSTNNKWLM
VQDGYQTAKSWLKTCSDKGVWTMIQPSSGGQCHFPDYSANYDFENTLFAEFFRDYPSFIG
YNYSEQFWGFQSEDFPVTPLQRYQHFAGLLKLCNKYGGYLNISWCANQWSSPLNPIAMLK
KCTEWREACSLYSENYILEEKYTQGSFIEDVESEVLGAYLSGNCGNFGVRYDETGWTDRS
ADDKPLSSKNQYRVSTGLPIVLERMAFNGATIIDGPELIWADDFKEVGGVKDSEGYNVRS
WAMHDQYQNDFLDVFRKVISGTIKIPTRQEVIDRTKVVVIQDNTTGDDHNKYSTYATLFE
GLYRMPGDGNLKDNTNLYKSTGRYPTIPTVYALNDELAKSFDVQLRQSQLSSRWTTIAAK
QNEFNKLFPSEYSGNCYAGRYENTWVTYNPNKIGTAAGGYLALKYNTCKQMEVTYSEYAS
GLINEYSDHINIYLNNYDEDNKTTLKTNTFKFYGCTSNPTFTYKDRGVNQAKSIVSGSLS
SDGTYTLTVQHNGPLDLTVNCSGAETNRLKNYSTATVTKPASASFYTGTRQYEGEFFDTK
NVEGNVANGCSSGITGYWGQGFMKFGTKSTAAVKDTVTTTKAGSFDWTLRYAVTSDINCV
DLYVNGTKVKTLSLSKGASLSDWKTIKQSISLNKGDNKVEVKATATLASTLYLDNFVVSG
DFGDATVTAPTTPTVPTMGNTVTLNDGWYCIKNVNAQKYLQVAKNIGQAAQNVELGTGSG
AIGQKWYLKNVGNGYVTLKSALGEFMVDVANGEDKDGTNIQIYNAYSNNAQKFSIKAPST
AGAYAIATMASNQTKVLDDYNFETAEGTKVCQWTYGGKNNQLWTFEETKYSNTIIGDVND
DDKVNSLDYALLKSYLLGNPTNINTENADLNSDGKINALDFANLKVFILGKVA
Download sequence
Identical sequences A0A173MZY6 D9SVB3
WP_010076104.1.47838 gi|302874168|ref|YP_003842801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]