SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875418|ref|YP_003844051.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875418|ref|YP_003844051.1|
Domain Number 1 Region: 179-501
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.97e-63
Family beta-glycanases 0.00019
Further Details:      
 
Domain Number 2 Region: 510-578
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.1e-17
Family Type I dockerin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 77-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000204
Family Family 6 carbohydrate binding module, CBM6 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302875418|ref|YP_003844051.1|
Sequence length 580
Comment Dockerin type 1 [Clostridium cellulovorans 743B]
Sequence
MNKKTITKVFSILSSTAMLPILSSINVTADTVTTEGVKYEFEKGISNGAQIYTDYTGTTD
DGLPIDLKGASCSFIGQKGTSTSVDINVDKAGLYELIVNYAEPFDKNKKVQYLNVNGTNQ
GEVSFPYSLGWKNLSAGIVKLNAGTNNIQFESYWGYTFFDYLIVKPADESITNLKGDKTL
VNPNATNEAKALKSYLADVYGKHIISGQQELCGSHNYSGSESDFAYIKEKTGKMPALRGF
DFMNYRGNGLLWDDNCAERVIDWYKNQNGIPTVCWHWFSPGNIGKKGDSSFYTKDTTFSI
SKALTPGTEENTAMMNDIELMAGKFKQLQDAGVPVLFRPLHEAEGGWFWWGAEGPENCVK
LYRLLYDQFTNKYGLNNLIWVWTSYTYETSPQWYPGDDVVDIVGYDKYNAKDGKPNGSAI
SSTFYNLVQATGGKKLVTMSENDTIPQVSNLTNEMAGWLYFCPWYGYWLTGEQNNPVSWL
NEIYNSDYCITLDELPNLKTYPISSTIDPKITYGDLNGDTKINAIDMALMKSYLLGNITE
FKVPIAAADLDGNKSVNAIDLALLKKYLLGNLSIFPSNGK
Download sequence
Identical sequences A0A173MZP1 D9SQT1
gi|302875418|ref|YP_003844051.1| WP_010075547.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]