SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302875726|ref|YP_003844359.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875726|ref|YP_003844359.1|
Domain Number 1 Region: 188-534
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.15e-81
Family beta-glycanases 0.00000289
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2e-35
Family CBM22 0.00081
Further Details:      
 
Domain Number 3 Region: 544-606
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.44e-16
Family Type I dockerin domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875726|ref|YP_003844359.1|
Sequence length 607
Comment glycoside hydrolase family protein [Clostridium cellulovorans 743B]
Sequence
MNLSKRLLSCVLSAGIVASAFAVATPVYAEDALLISSTFEGGTDGWSTMGTTTISPSTLS
HSGNGSLYVSGRAASWAGPCNIRTDVLKAGNTYNLSSYVMYNDASAADTQPISFMLKYTD
STNKAFYVPIATVTVNKGEWTKIENTAYKIPAEATSAMIYWETTGTMINYYVDDVTAYGP
STFNPNVTAATPLKNVFGKYFDIGCAATPSEVSLQVAKDLVKTHYNNLTIGNELKPDYVL
DKAACQASGNNVNPQVKLDSARSLLKYCAENNIEVRGHVLVWHSQTPSWFFKENFSDTGA
TVSKDVMNQRLENYIKNLFAAINAEFPTLKIYAWDVVNECYLDGGNLRTAGFPETAGKEA
SAWNLVYGDDSYIDNAFTYARKYAPAGVKLFYNDFNEYIQSKRNAIYTMAMRLKSKGIID
GIGMQSHLDMGFPDTNTYKAALTKFGSTGLEVQVTELDITTSDTSATGLANQATKYAAIM
QSILDAKKAGTANITNVVFWGITDGTSWRATRLPLLFDGNYYPKPAFDSVVKLVPTSDYY
TPGYALGDVNNDGKINALDLALVKKGLLSEFTDPAAKVAADVNKDGNTNAIDLALLKKYL
LGQITSF
Download sequence
Identical sequences D9SST3 Q6J286
WP_010075688.1.47838 gi|302875726|ref|YP_003844359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]