SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302876061|ref|YP_003844694.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876061|ref|YP_003844694.1|
Domain Number 1 Region: 155-264
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000222
Family Collagen-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 570-677
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000248
Family Collagen-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 32-146
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000131
Family Collagen-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|302876061|ref|YP_003844694.1|
Domain Number - Region: 293-381
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000248
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302876061|ref|YP_003844694.1|
Sequence length 681
Comment peptidase domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MLRFKKSIACLITASTVILSSAIPALATVGMTESTANDSVATATVIPSNFDLTQEIQGSI
ENPGDVDYYKFVPLNSAGYSISTLGSTDTFGYLYDSDMNILDVNDNESYPYTNNFQLCYN
LTAGNTYYIKVSHKNTTDTGSYTLKIDPICNYYNKEIESNNSFETATSLPTVVTNMPAAI
GTAGDEDYYSFTLPGGGNFTIETTGSTNTFGSLYDSNHNLIASDDNNGDDNNMKIVSALA
GRQTYYVKINHASTSGTGSYNLKISETASDYDLDGNDFTSARDLTLATNNAVSYSGSGIN
YSGDIDYFKFVPKKDGIYTFKSSGLTNVDGAVLDSNNQVIKSDTNSGHDGNFMIDVSLTA
NQTYYLMVASSQGVTGKYSLDIGRGKCLNVPQYLQLPHDMLCWASTASMAISYLNHDTID
RTLEIAQKNAKTNYASSNEPTLYGPDYYKYPSVFNKPGYLQDCSGYIDPSIHPSVHTRPS
DLHPGVDYSCGYTQDELMQSIDKGYPIIVMISNGNGGNHSVILKGYIEDTNGVINTIYND
PLDGQEHMVSAISPLGYVAFCSYTPPVPVPDQEPANNTKEGADYLSSDQPIQGSIGQAGD
VDFYKFGFGNTQNRQCILETTGTTDTYAEVYDSNGNLVASADNGGEGTNFKIQFTGSPYS
NYYIKVSGTGTGSYTLSYTTN
Download sequence
Identical sequences D9SUH5
gi|302876061|ref|YP_003844694.1| WP_013291835.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]