SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297543615|ref|YP_003675917.1| from Thermoanaerobacter mathranii subsp. mathranii str. A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297543615|ref|YP_003675917.1|
Domain Number 1 Region: 331-403,434-828
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.28e-94
Family Amylase, catalytic domain 0.000000328
Further Details:      
 
Domain Number 2 Region: 243-361
Classification Level Classification E-value
Superfamily E set domains 5.88e-25
Family E-set domains of sugar-utilizing enzymes 0.0011
Further Details:      
 
Domain Number 3 Region: 927-1017,1145-1242
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000163
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 4 Region: 1250-1345
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000000957
Family Starch-binding domain 0.0083
Further Details:      
 
Domain Number 5 Region: 828-918
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000216
Family alpha-Amylases, C-terminal beta-sheet domain 0.01
Further Details:      
 
Weak hits

Sequence:  gi|297543615|ref|YP_003675917.1|
Domain Number - Region: 53-103
Classification Level Classification E-value
Superfamily E set domains 0.00355
Family AMPK-beta glycogen binding domain-like 0.062
Further Details:      
 
Domain Number - Region: 1089-1152
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0811
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297543615|ref|YP_003675917.1|
Sequence length 1834
Comment alpha amylase catalytic subunit [Thermoanaerobacter mathranii subsp. mathranii str. A3]
Sequence
MFNKRILGFLLSFLLIFTAVFGSMPMEFAKAETDTAPATAVVAGNFQSKLGDTDWKGDSS
ITVMTYKGNGFYEYTTHTALPAGDYEYKIVLNGSQWIPDGFGNNLKFHLDKDSVVTFYYN
YSTSSVTDSTKYTPIPEEKLPRIVGTIQSAIGAGSDWSPETSTAVMRDYKFNNVYEYTAN
VPKGNYEFKVTLGPSWDINYGLNGEQNGPNIPLNVAYDTKITFYYDSVSHKIWTDYNPPL
TGPDNNIYYDDLRHDTHDPFFRSPFGAIKTGDTVTLRIQARNHDLESAKISYWDDIKKTR
IEVPMYKIGQSPDGKYEYWEVKLSFDHPTRIWYYFILKDGTKTAYYGDNDEQLGGEGKAT
DTVNKDFELTVYDKNLDTPDWMKGAVMYQIFPDRFYNGDTSNDHARTLSRGSDPVEFHDD
WYELPDNPNDKDKPGYKYDGIWNNDFFGGDLKGIDDKLDYLKELGISVIYLNPIFDSPSN
HKYDTADYSKIDPMFGNLDVFKKLMEDAHAKGIKVILDGVFNHTSDDSIYFDRYGKYLDK
GLGAYQAWLQGDQAKSPYGEWYEIKPDGTYEGWWGFDSLPVIRQINGSEYNVKSWADFII
NNSDAISKYWLNPDGDTNAGADGWRLDVANEVSNDFWTHFRNSINTVKSNAPMIAEVWED
ASSYLLGDSFNSVMNYLFRNAVIDFILDESFDDGNVVHNPIDAAKLNQRLMSIYERYPLP
VFYSTMNLLGSHDTMRILTVFGYNSADENQNSQAAKDLAVKRLKLAAILQMGYPGMPSIY
YGDEAGQSGGKDPDNRRTFPWGREDKDLQDFFKKVVNIRNENQVLKTGDLETLYANGDVF
AFGRRIINGKDVFGKSYPDSVAIVVINKGDAKQVSIDTTKFIRDGVTFTDALSGKTYTVN
DGQIVVEVGSMDGAILISDPGQNLTAPQPIQDLKAVSGNGKVDLSWSAVDRAVSYNIYRS
TVKGGLYEKIASNVTQTSYTDTEVTNGLKYVYAVTAVDNYGNESALSNEVEAYPAFPIGW
AGNMNQVDTHVIGVNNPVEVYAEVWAEGLTDKPGQGENMIAQLGYRYLGDTVGYAVYSDV
YNGVEGVAINSDWTWVDAQYVGDSGNNDKYMAKFVPDMVGTWEYIMRFSSNQGQDWTQTD
VKQFTVVPSNDSVPPTVPVLQQPGIESSRVTLNWSPSADDVAIYGYEIYKSSSETGPFVK
IATVSDSVYNYVDTDVVNGNVYYYKVVAVDTSYNRRASNTVKATPDIIPIKVTFNVTVPD
YTPDDGVNIAGNFPDAFWNPTAQQMIKTGPNTYSITLTLNEGTKIEYKYARGSWDKVEKG
EYGEEIDNRKVTVTNQGSNTMVINDTVQRWRDLPIYIYSPKDNTTVDANTSEIEIRGNTY
KGAKVTINDESFVQQENGVFTKVIPLEYGVNTIKIHVEPSGDKNNELTKDITITVTREKP
GHERQPTPTSPTEPSEEVSQGRVVVENNTTILKVDENKVAKDIKDTSKQEIQFDLTNIGT
TPQKALEIPVTVFNLIVEYNKNVVVKSEEVALQFDAKTLTISQEAIDLINKAGTIKLNIH
NKGKKEASTFEPVTDAYDITIKAGDKDIKIGSPVKMTFNIEGAKDIRKVGAYYLNETTNQ
WEYIGGKIDRETNTITFEAKHFSTYAAFQYNKQFKDVSKDNWAYDVINVLASRHIIKGID
ENTFLPNKKITRAEFAALMTRALGIEEKPYKGQFNDVKEGAWYANAVEAAYKAGIILGDG
KNMRPNDPITREEMAAVIMRVYGKLVEYREDNIGNTTFSDNNKISEWAKNAVANAVKLGI
VKGYKDNTFRPKENATRAEAAAMLYRVLEKTGNI
Download sequence
Identical sequences D7AQM0
WP_013149578.1.86608 gi|297543615|ref|YP_003675917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]