SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297545348|ref|YP_003677650.1| from Thermoanaerobacter mathranii subsp. mathranii str. A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297545348|ref|YP_003677650.1|
Domain Number 1 Region: 45-476
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.41e-75
Family Amylase, catalytic domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 653-755
Classification Level Classification E-value
Superfamily Starch-binding domain-like 5.15e-30
Family Starch-binding domain 0.0000974
Further Details:      
 
Domain Number 3 Region: 480-569
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.44e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.00048
Further Details:      
 
Domain Number 4 Region: 577-652
Classification Level Classification E-value
Superfamily E set domains 0.00000000014
Family E-set domains of sugar-utilizing enzymes 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297545348|ref|YP_003677650.1|
Sequence length 757
Comment alpha amylase catalytic subunit [Thermoanaerobacter mathranii subsp. mathranii str. A3]
Sequence
MAALIKKKNLSVLVVVIILLVFFFSFQPVTAEATSTGGLGPVTPKDTIYQIITDRFYDGD
PSNNIPPGFDPTLFDGTGTDLKLYQGGDWKGIIEKIPYLKEMGITAVWISAPYANRDTVI
EDYHPDGSVDRWTSFHGYHARNYFATNKHFGEMQDFIALRDALHSNGIKLVIDFVSNHSS
RWQNPTLNYQPEDGRLYEPDKDENGNYVFDSNGNPADYNGDGIVENLLADPHNDIDGFFH
GLGDRGDDTTRFGYRYKDLGSLADYSQENPGVVEHLEKAAIFWKSKGIDGVRHDATLHMN
PAFVQGFKDAIDSAPGGPLTHFGEFFIGRPDPKYEEYRTFPDRTGVNNLDFEYYRAATNT
FGYFSETMRDFGEMMIKTSNDYIYENQAVTFIDNHDVTRFRYIQPNDKPYHAALAVLMTS
RGIPNIYYGTEQYLYPADDSDIAGRMFMQTSTSFDQTTTAYKLIRKLSDLRRSNEAVSYG
TTEILYSTDDVLVFKRQFYDKQVIVAVNRQPDRSFDVPDLNTTLPVGTYHDVLEGLLYGK
SMSVVEENGQLKIKGFTLSGGEVNVWSYNPSLGTEIPRIGDVISTMGRPGNLIYIYGTGL
GGNVTVKFDTTLAQVVSNSNEMIIAVVPNTPGIKNITVEKGNYTSNPFRYHVLSGDLVQV
IFKVNATTEWGQNIHIVGNLPELGNWDPTLSTEAMMCPNYPEWFLPVSVPMGTTFEFKFI
KKDSNGNVIWESGENRIFTSPNISTGTVDTPLYNWRD
Download sequence
Identical sequences D7AS74
gi|297545348|ref|YP_003677650.1| WP_013150819.1.86608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]