SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297544253|ref|YP_003676555.1| from Thermoanaerobacter mathranii subsp. mathranii str. A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297544253|ref|YP_003676555.1|
Domain Number 1 Region: 99-489
Classification Level Classification E-value
Superfamily Subtilisin-like 1.83e-83
Family Subtilases 0.00000844
Further Details:      
 
Domain Number 2 Region: 461-561
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000157
Family Collagen-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297544253|ref|YP_003676555.1|
Sequence length 576
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Thermoanaerobacter mathranii subsp. mathranii str. A3]
Sequence
MKNRQVLKVLLAFVLIVTLMSLSGVLAQAQPNLTNLSGDFPTKNYPPQIQKVLMQDSNKN
KIFDNLEAKLTDKPDSTEFPVIITFNKNIDDNELLNISKSIGKFNIKHKYKIIPGVAATL
TKGQINALSKLDIVKQIEYDEPVYATLDTATKWFGVTKARSDFGVTGDKDGNPSSYSKND
IVIAVIDTGIDGSHVDLAGGKIIGWQDFVNGKTAPYDDNGHGTHVASIAAGTGTGNSLYT
GVAPGAALVGIKVLDSNGSGSMSTVTAGIDWAVQNKDVYGIKVINLSLGTSTSSDGTDST
SLAVNSAVDSGIVVVVAAGNSGPARYTIGSPGAAEKAITVAAMADVGELGFNLASFSSRG
PTADGRIKPDIAAPGYNITAAKANSINGYVTYSGTSMATPFVAGTVALMLNANISLAPLD
VKNIIMTTAKSWGPPTKNIDYGAGRLDAYEAIETAGNLTGTNISVPNHYYAKDSLPGSRY
SDIWTFNVTDTSYPIAITFIIPDWANYNPDFDIYLYDPTGTLVKSSTGIQRQETITYIPT
QTGTYYIKVYSYRGSGNYYFDLSTGGDSLTLSSNDI
Download sequence
Identical sequences D7AU37
WP_013150072.1.86608 gi|297544253|ref|YP_003676555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]