SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302868474|ref|YP_003837111.1| from Micromonospora aurantiaca ATCC 27029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302868474|ref|YP_003837111.1|
Domain Number 1 Region: 1-56,112-429
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.08e-78
Family Gtf glycosyltransferase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302868474|ref|YP_003837111.1|
Sequence length 431
Comment hypothetical protein Micau_4012 [Micromonospora aurantiaca ATCC 27029]
Sequence
MRVLFTTFAQPTHLHAQVPLAWALRAAGHDVRVASQPDLTEAITGAGLTAVAVGEPLNQQ
EQVRELDEQHRREVEEAPDDEPAPADYIELTDISELRDEILTYEYVQRQLTAVTMFGFRT
LCPDRMIDDLVAFARDWRPDLVVWDSVTFAGSVAAIASGAAHGRLLFGLDLVGHVRQRHL
ELLRGRVPALRDDPLQEWLGDVLARHGHPFTEQAVLGQFTIDPVPASLRLPVDHHYLPMR
YTPYNGPATVPDWLREPPTRPRVCLTLGRSFRETLGGDRTAVTELLDAVATLDVDVIATL
SSSQIPPGHPIPDNVRTVEFVNLDVLLPTCAAIIHHGGSGTSQTALIHGVPQVIVPYKLW
CNGPRAERMERAGVAVCGVAGRSAASEVRALIRRVLDEPSFRACAGDLRHEMLAASTPAE
LVPVLRRLAQT
Download sequence
Identical sequences D9T2A9
WP_013287159.1.81987 gi|302868474|ref|YP_003837111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]