SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302347984|ref|YP_003815622.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302347984|ref|YP_003815622.1|
Domain Number 1 Region: 53-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000218
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302347984|ref|YP_003815622.1|
Sequence length 310
Comment hypothetical protein ASAC_0184 [Acidilobus saccharovorans 345-15]
Sequence
MRAEVETGSRLHGGFYYAAGDWNVRWGSIGFYVDNPKFRAAVELSDREQYRGPQELLEYV
KKAAKVAGVQGFNVEVHESPPIHRGFGTGTQVLLSLYMAFKALKGEQPEAVEEAALKLGR
SRHSGAGTLAFKYGGFVMDAGLPGRPTPLVTLKMPSEWRFVIIIPKIERGLTDEEEESIM
EKRQWGNSESNIAFMTSGALRLAAGIARGDLDDALEGLRFVQRGTGILFASVQGGEYRGK
LNDLAAEAWRSRVILAQSSWGPAMYTIVENEYEAQGDVMLMKEIMSNVGLSGEVIISPPR
NYGASIKIVG
Download sequence
Identical sequences D9PZV3
gi|302347984|ref|YP_003815622.1| WP_013266103.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]