SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348020|ref|YP_003815658.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348020|ref|YP_003815658.1|
Domain Number 1 Region: 322-481
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-56
Family DNA gyrase/MutL, second domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 21-238
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-33
Family DNA gyrase/MutL, N-terminal domain 0.000000835
Further Details:      
 
Domain Number 3 Region: 241-302
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000000235
Family Topoisomerase VI-B subunit middle domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348020|ref|YP_003815658.1|
Sequence length 556
Comment type 2 DNA topoisomerase 6 subunit B [Acidilobus saccharovorans 345-15]
Sequence
MAEENAIDNAKEKFSEISVAEFFSKNKELAGFSNPTRALYQTVRELVENALDATDSHGIL
PEVKIYIKEVEPENEERPARYEVSVEDNGIGVPKTVMAQAFGKVLFSSKYVIRQTRGMYG
LGVKAVVLYSQTTTGRPITVVSSQEDSNFVYYQNIKIDIKKNEPMVVEDGQLDKRSSWHG
TIASAIVEGDWTRAKPKIIEYVRRTAIIAPYAELWLVTPEGEIYFFPRATKKMPKPPREA
KPHPHGVDLEQVRSMLMSTQAETLLDFLKEEFQGIGDKTATEFLRHVGLKPDINPKTLLK
KEKLKDLEALVTALRNYRGFKGPRSDYLSPIGEELIELGLTRMFKPEWVKAVTRPARAYQ
GHPFIVEVGIAYGGAIQPQEEPILLRFANKIPLLYEEKEDVSYKVLTNIDWGRYGVQEPY
QLAVLVHVASTKVPYKGVGKESISEIPELESEIRNGIHEVARSLRIYISRKAREELAKEK
IVSIAKYIPEVARSLAILSSPPEDPNRYRELEPKVMELLISKVAASIEMPKIDGRQEDPR
LIVERVIKGVSIQEVS
Download sequence
Identical sequences D9PZY9
WP_013266139.1.78912 gi|302348020|ref|YP_003815658.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]