SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348046|ref|YP_003815684.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348046|ref|YP_003815684.1|
Domain Number 1 Region: 58-253
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.15e-60
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000961
Further Details:      
 
Domain Number 2 Region: 590-738
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.02e-46
Family AlaX-like 0.0018
Further Details:      
 
Domain Number 3 Region: 300-502
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.57e-41
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00024
Further Details:      
 
Domain Number 4 Region: 499-580
Classification Level Classification E-value
Superfamily Translation proteins 1.8e-17
Family AlaX-M N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348046|ref|YP_003815684.1|
Sequence length 913
Comment Alanyl-tRNA synthetase [Acidilobus saccharovorans 345-15]
Sequence
MNPSEYRLPFFKEQGYQRKQCRVGGDFFWTLNASFDTCQDVPDTDYWFDRIPSVPGLTVA
EARRKFIDFFARHGHTPIQPRPVVARWREDLYLTIASIVDFQPHVTSGLVPPPANPLVIS
QPCIRLEDIDNVGLTIGRHLTTFEMAAHHAFNYPDKQVYWKDETVRYAYEFFTKELGIPG
DLIVFKESWWEGGGNAGPSFEVTVGGLELATLVFMQYKIDENGNYVELPLKIVDTGYGVE
RMAWFTQKTPTAFHAIYGQLLDKARSELGLPRPPEEYLWAAFRAAAKFNPDVEGSLDAFY
QQVSKTTGAPLSEVRQVLEREARLYSVLDHSKTIAMMLGDGVVPSNSGEGYLARLVIRRA
LRQLRLLNENYDLAKIVDMQIDLWGSDFPQLKENRSYIIEAVGLEEDRYKDLLRRGEKLV
LRELSQGASLETLIKLYDSYGIPPEVAAEAAAKKGITVLVPRNFYSLVAARHRAPAKVRS
IEEKSSLPEDVVSWARQFKPTELLFHKDPYARSFTAKILGVKGEYVVLDSTIFYATGGGQ
LNDVGVMEICGERYNVVDVQKAGDVIVHKLDRAVDNASCGEARGEIDWVRRFRLMRHHTA
THIILGAARRVLGNHVWQAGAEKTPEKARLDITHHKPLTREEVRRIEELANRVIDERRPV
LQAYMDRNEAESKYGFVLYEGGVPMERKIRVVEVQGWDVEACFGTHVTNTGDIGGIKIIN
VEKIQDGVVRLEFVAGTRVPEEMAALEDRMTQLSSELGSQGGEELNKVKELKDELMKLKE
SVKAYRSLWLSTAKGLIVSSKVNGLIVATLEYPEPDVKSARDALKELTDEFINSVITVAV
KEDKGYRYELGIGREASRILSAEAILAAISSELKVTGGGRGTYGSFFTSEVPEKVDAIIK
RSVSRIVSQNAQS
Download sequence
Identical sequences D9Q015
gi|302348046|ref|YP_003815684.1| WP_013266165.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]