SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302348069|ref|YP_003815707.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348069|ref|YP_003815707.1|
Domain Number 1 Region: 155-440
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.73e-71
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000125
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily tRNA-binding arm 1.41e-24
Family Seryl-tRNA synthetase (SerRS) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348069|ref|YP_003815707.1|
Sequence length 459
Comment Seryl-tRNA synthetase [Acidilobus saccharovorans 345-15]
Sequence
MPWSILNLLRTNPEALREVARKRQIDVKIIDEAVQLDEQWRKVQAEINELRHQHNVISAA
IPKAKGEEREKLLAQAKELSRELEDAERRLSELEAKREEALWRLPNVVLDDVPVGGEEAT
RPVRFWGTPRVYHEYLDAFKAQTEAYGFNVPYELIDWKPVGHADMLENVLKLGDTEKASE
VAGSRFYYLFDDLVWLDFALLLYAIDKLTSKGYTLVLPPYMLRYKVINSVIDLATFQDAI
YKIENDDLYLIATAEHSLAAMYYNEELYDDELPKKFVGISPAFRREAGAANKDLKGIFRV
HQFHKVEQFVFSKPEESQKIHEELISNAEGLFQGLGIPYRVVNIASGDLGACAVKKYDLE
AWMPAQGKYREMVSASNCTDWQAYRLNIRLIRRKGMERGEYVHTLNSTGIASTRTITAIL
ENFQEPDGTVIIPKVLRKYLEPFDAAPKDFIKPRPRKAI
Download sequence
Identical sequences D9Q038
WP_013266188.1.78912 gi|302348069|ref|YP_003815707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]