SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348073|ref|YP_003815711.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302348073|ref|YP_003815711.1|
Domain Number - Region: 52-121
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0032
Family GHMP Kinase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348073|ref|YP_003815711.1|
Sequence length 261
Comment hypothetical protein ASAC_0273 [Acidilobus saccharovorans 345-15]
Sequence
MWGSTPRDSGSVGVGIAVEPRLELCYDLKLSGEPAGTAAKLLESNGVDLSKVKSSNPLPW
SFGYATSGASAVAAAHLASYLKGKSLGSLLVQAHEIEVQDRTGLGDVLAISCGLGLVLRR
RAGPPGIGQVDCLYLPRSISLLSIEAGGMSTESLLSSLGDDFYVESSNVLRKLDEELSLE
AFIESVRALNDKLGLPSSILGAQNFEYVTKVPGLLGYYTKKRLVILIIERDLVGDAVDYL
RKGLPYDIRELSPSEAGPYLR
Download sequence
Identical sequences D9Q042
gi|302348073|ref|YP_003815711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]