SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348093|ref|YP_003815731.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348093|ref|YP_003815731.1|
Domain Number 1 Region: 40-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000087
Family Transcription factor E/IIe-alpha, N-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|302348093|ref|YP_003815731.1|
Domain Number - Region: 153-191
Classification Level Classification E-value
Superfamily Prefoldin 0.00191
Family Prefoldin 0.018
Further Details:      
 
Domain Number - Region: 121-156
Classification Level Classification E-value
Superfamily ENV polyprotein, receptor-binding domain 0.00902
Family ENV polyprotein, receptor-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348093|ref|YP_003815731.1|
Sequence length 194
Comment transcription initiation factor IIE, alpha subunit [Acidilobus saccharovorans 345-15]
Sequence
MSGEGNGNNEDDKSLEGLRQLIRMLAVKSGIDEAMADDLFDLLLTVDPEKGISDEEVEQM
KGYKQADVRKVFRIFYDLRIASYRRGKHPDTGATRYYWYLDSRDADLALLRRKKQVLEKL
KMRLEYERSNEFYVCPKDGTRYTFDYAYEYQFTCQKCGTMLVPEDNSSYIRVLENRISRL
EEEIKRDERQIFGH
Download sequence
Identical sequences D9Q062
WP_013266212.1.78912 gi|302348093|ref|YP_003815731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]