SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348165|ref|YP_003815803.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348165|ref|YP_003815803.1|
Domain Number 1 Region: 93-237
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.02e-29
Family AlaX-like 0.01
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000194
Family AlaX-M N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348165|ref|YP_003815803.1|
Sequence length 248
Comment threonyl/alanyl tRNA synthetase, SAD [Acidilobus saccharovorans 345-15]
Sequence
MVRLLYQEDSYVKEFEATVTRVDQNKIYLDATAFHPGPSGGLDADTGLLVLPSGSTVRVV
NVIEDGDDVAHITEAPVQLSPGDKVKGVLDWERRYSMMRLHTASHVLAAVLYNKYGAKIT
GGHIKPDEAQDDFDLSGVENWRQAILTAVDEANNVLSRCIDVKVYWLERDRALQIPGIVK
LAGRLPPAVDKLRIVEIPGVDIQADGAPHVKNTCEVGHIEVVSVENRGKTRKRVYYRLSQ
VPAGARTA
Download sequence
Identical sequences D9Q0D4
WP_013266284.1.78912 gi|302348165|ref|YP_003815803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]