SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348184|ref|YP_003815822.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348184|ref|YP_003815822.1|
Domain Number 1 Region: 7-109
Classification Level Classification E-value
Superfamily Prefoldin 9.16e-21
Family Prefoldin 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302348184|ref|YP_003815822.1|
Sequence length 124
Comment Prefoldin subunit beta [Acidilobus saccharovorans 345-15]
Sequence
MPPEAEVKYNKYLQLRDTYNAIVQQRLAAESSLSEIEKVIETLNGLSDSAEVYKMAGFVL
VKSTKGDLLKELQDRKENLELKIKALKNQENLVKDELDKVAGELQRLLQGAVGGGGAAGP
AGGS
Download sequence
Identical sequences D9Q0F3
WP_013266303.1.78912 gi|302348184|ref|YP_003815822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]