SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348679|ref|YP_003816317.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348679|ref|YP_003816317.1|
Domain Number 1 Region: 3-76,162-334
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.6e-76
Family Pyruvate kinase 0.0000259
Further Details:      
 
Domain Number 2 Region: 318-447
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 2.01e-16
Family Pyruvate kinase, C-terminal domain 0.0088
Further Details:      
 
Domain Number 3 Region: 71-162
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000000244
Family Pyruvate kinase beta-barrel domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302348679|ref|YP_003816317.1|
Sequence length 460
Comment Pyruvate kinase (PYK) [Acidilobus saccharovorans 345-15]
Sequence
MKRLAKIMVTMGPSTLDYAIVRRMMSAGADGFRINMSHGDEKQWATFLELIDKASQELGV
HVAKVADLEGPRVRLGEFQGVDIAPGQQVRFKYKDAQGEGIPVDNRAFFASLERGDRVLV
DDGKVVLSVEDIERDSATLRVISGQRLEPRKGVVLAGKEYDLPPVTEKDLQNMKFIAANN
FDYVMASFVRSARHVEIIRKALSDAGAKDVKLLAKIETPSGVNNIDSILDVVDGIVVARG
DLGMHFPLEDIPVIQRRIIEAARRKLKPVILATEIFMSMIERPLPTRGEISDVYAGIEEG
VDGFLVTSETSIGKYPAEVVSWLSRVIEEANKNVRPRRVDQLTSSLESRISRGVVEMAQN
VGASVVVYAHDFDVARLISAFRPGTSIYVGVPTTQLARQLSLLWGTVPVVVGPADSEEQG
LEATEKELESKGITGPGSLLVELSWTPDRSTAVVKVKQVF
Download sequence
Identical sequences D9Q1U8
gi|302348679|ref|YP_003816317.1| WP_013266798.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]