SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348818|ref|YP_003816456.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348818|ref|YP_003816456.1|
Domain Number 1 Region: 141-211
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000606
Family Elongation factors 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348818|ref|YP_003816456.1|
Sequence length 304
Comment Selenocysteine-specific translation elongation factor-like protein [Acidilobus saccharovorans 345-15]
Sequence
MIASLVSADMNRAQELAGSIAKLNDKGHLLMYYKRLSEEKLLSIIVPTEYPATIINAAIS
MSLADIGVVVTGYEMDWRDGELLTLVDASSSQLGLAAADSKESIEKLVNSSGLRLSTLST
SDFAVSLLTHGEKLSSHDEGYVFIDRAFLVKGVGPVILGYTKMNVYVHDKLYAVPINKQI
EIKSIEVLDEEMDSVGPGVRIGFAVKGAEVDELKEVYALVPDLSKTVNKLTLRVKAYPWT
EVPSSGTLHVVGGGTAVMANIDRYDNGSIELSLSKPLPLLDKYLLVNVNAKQKRSRVLGY
LFPG
Download sequence
Identical sequences D9Q287
gi|302348818|ref|YP_003816456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]