SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348895|ref|YP_003816533.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348895|ref|YP_003816533.1|
Domain Number 1 Region: 9-69,97-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.18e-47
Family G proteins 0.000000248
Further Details:      
 
Domain Number 2 Region: 217-328
Classification Level Classification E-value
Superfamily Translation proteins 6.45e-37
Family Elongation factors 0.00001
Further Details:      
 
Domain Number 3 Region: 332-421
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.28e-27
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348895|ref|YP_003816533.1|
Sequence length 424
Comment translation initiation factor 2 subunit gamma [Acidilobus saccharovorans 345-15]
Sequence
MSEESATEVKREDEERPQPEINVGVVGHVDHGKTTLVQALTGVWTMRHSEEIKRGMTIKL
GYADGEIWECEGCEFPEKFSTEPVCECNPGAKPKLLRRVSFVDAPGHEILMATMLSGAAL
MDGAILVVAANEPAPQPQTKEHFLALSILGIKNLIVVQNKVDVVSPERAHESYKEIKKFL
EGTWAEDAPIIPVSALKRVNIDALLAAIQAYIPTPERDLSSPPLMYVIRSFDVNRPGTPP
SELVGGVLGGSLVTGTLKVGDEIEIRPGLQVKEGAKIRYEPIQTEVTSLYFGKYPVKEAK
PGGLVAVGTKLDPSVTKADNLAGNVVGRADNMPEVFDTLSIEHHLFETVVGMKESVRVEP
ITKGEPLLLAVGPALTLGDVISSTKDVVTVRLRRPVAAWKNVRIAISRRVAGRWRLIGWG
LAKV
Download sequence
Identical sequences D9Q2G4
WP_013267014.1.78912 gi|302348895|ref|YP_003816533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]