SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348938|ref|YP_003816576.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348938|ref|YP_003816576.1|
Domain Number 1 Region: 81-153
Classification Level Classification E-value
Superfamily Hypothetical protein AF0491, middle domain 6.28e-23
Family Hypothetical protein AF0491, middle domain 0.00026
Further Details:      
 
Domain Number 2 Region: 4-86
Classification Level Classification E-value
Superfamily FYSH domain 3.01e-22
Family Hypothetical protein AF0491, N-terminal domain 0.00086
Further Details:      
 
Domain Number 3 Region: 156-227
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.93e-18
Family Hypothetical protein AF0491, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348938|ref|YP_003816576.1|
Sequence length 234
Comment hypothetical protein ASAC_1140 [Acidilobus saccharovorans 345-15]
Sequence
MPKKQDYVIAWIDIKGQHFEILVKPDEAFKFKEGEKVSISDVLWSDTVYKDVRKGLKASP
EAIKKAFGTDDINSIAERILKEGQIQITEEERRKIIEMKRRQIITYIARNAVDPKSGSPI
PEQRIENLFEELRIGVDPFRPVEQQALEAIKKMATVIPIKIARALVEVTIPPEFAGRAIG
EVKRLGDVKKTTWLDDGSLKVELEIPAGMQLEVIDKIQGLTRGQAQINVKVSSQ
Download sequence
Identical sequences D9Q2K7
WP_013267057.1.78912 gi|302348938|ref|YP_003816576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]