SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348960|ref|YP_003816598.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302348960|ref|YP_003816598.1|
Domain Number - Region: 136-199
Classification Level Classification E-value
Superfamily Translational machinery components 0.000471
Family ERF1/Dom34 middle domain-like 0.048
Further Details:      
 
Domain Number - Region: 448-529
Classification Level Classification E-value
Superfamily Prefoldin 0.0222
Family Prefoldin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348960|ref|YP_003816598.1|
Sequence length 670
Comment hypothetical protein ASAC_1162 [Acidilobus saccharovorans 345-15]
Sequence
MSSEGAPQELYMGVDIESGSPLSSTNRAKYSVVIIDQSLKLIAKHQSVPLATIIRLAWEY
RPRSIASDNVMELSLDGSTESIARLLSLLPPGTKLVQATATEDGLVDVLEAARRAGIDVA
SSKLSPMRTAFIVAAVVAKGGGQSVGFSREKTYIVVSRGRNTKSGGWSQARYQRRIRASV
KIAADKVKEALDNANIDYDVFYKTSEGGLDSAIFIVYAPREKLIGIVRPHRGIDYSIRIE
TKYEGELVFGGATSKPSRPLIVGVDAGMTTGLAVLDLEGRVLHLGSYKELDRGKIVSIVS
SLGKPVIVTTDVADPPELIRKLAAQLGAQLYLPNYNMSVAEKEYLASRATANSELKPKTP
HERDSLAAAYRAFIEYHNKLSQVEAYASKLEFDIDIDELKADVVKGATLAEAVEKQIAKL
LGNIDEKYESMNVINRQQVQQPCADSSKVELLEAQKMSLEKQLEDLRQRLFYEERELYLA
KKQLKAELLKDDEIRALKGRVSELESSLAKLQGEQEHLQEEIQSLRRVLVDVASGRLVVA
RRVSELRSSQLKRSEEQLGPISANEVVIVDNVTAFDSNAVEYLSKAGVKAILVNDADSPL
ANAAKNRRIAPLRVNEYAIIQVAGLYFVSSKVISDAMEFIAKLKSQESSDAALLSLLNEY
RAMRGKGSTP
Download sequence
Identical sequences D9Q2M9
gi|302348960|ref|YP_003816598.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]