SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348981|ref|YP_003816619.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348981|ref|YP_003816619.1|
Domain Number 1 Region: 1-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-77
Family G proteins 0.00000013
Further Details:      
 
Domain Number 2 Region: 324-428
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.63e-39
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000349
Further Details:      
 
Domain Number 3 Region: 230-321
Classification Level Classification E-value
Superfamily Translation proteins 6.03e-29
Family Elongation factors 0.0000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302348981|ref|YP_003816619.1|
Sequence length 436
Comment Elongation factor 1-alpha [Acidilobus saccharovorans 345-15]
Sequence
MPEKPHLNLVVIGHIDHGKSTLTGSLLYRLGVIDPKIMQQLEEQAKAAGKESFKFAWLLD
KMKEERERGITIDLSFMKFETKKYYFTIIDAPGHRDFVKNMITGASQADAALLVISSRKG
EFEAGMSAEGQTREHALLAKTLGIEQLIVVVNKMDAPDVNYSQQRYEEIVNTMKKFLKGL
GYNVDAIPFVPVSAWTGENLIERSPNMPWYKGPTLVEALDNLKVPPKPVDKPLRLPVQSV
LSIPGAGTVVTGRVETGVLKPGDKVIVMPEGVVADVKSIQMHYQDLQQAEPGDNVGVALR
GVEKNQVKRGDVIGKTDNPPTVAEEFTARVVVVWHPSAIAVGYTPVIHVHTASVACRITE
IVAKLDPRTGNPIEQNPQFIKAGDTAIVKFKPIKPLVIEKFGEFPQLGRFAMRDMGRTIG
IGIVTDIKPAKIEVKK
Download sequence
Identical sequences D9Q2Q0
WP_013267100.1.78912 gi|302348981|ref|YP_003816619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]