SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348997|ref|YP_003816635.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302348997|ref|YP_003816635.1|
Domain Number - Region: 3-57
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00047
Family Phosphate binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302348997|ref|YP_003816635.1|
Sequence length 63
Comment hypothetical protein ASAC_1199, partial [Acidilobus saccharovorans 345-15]
Sequence
MFNLDFIPVGEEIYDFVVRKDRINKPSVRAFLETLKSPEFSEALSRALPGYRTLPESGKA
IYP
Download sequence
Identical sequences D9Q2R6
gi|302348997|ref|YP_003816635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]