SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348892|ref|YP_003816530.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348892|ref|YP_003816530.1|
Domain Number 1 Region: 6-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-54
Family G proteins 0.000000597
Further Details:      
 
Domain Number 2 Region: 341-463
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.83e-32
Family Initiation factor IF2/eIF5b, domain 3 0.000035
Further Details:      
 
Domain Number 3 Region: 471-592
Classification Level Classification E-value
Superfamily Translation proteins 1.25e-26
Family Elongation factors 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348892|ref|YP_003816530.1|
Sequence length 609
Comment translation initiation factor IF-2 [Acidilobus saccharovorans 345-15]
Sequence
MSTQSQQPKLRQPIVVVLGHVDHGKTSLLDKIRSTAVAAKEAGGITQHIGASIVPADVIE
KLAEPLRKLIPIKLSIPGLLFIDTPGHELFSNLRKRGGSVADFAILVVDVTKGFQNQTYE
SLDLLRSRKVPFLVAANKIDRIPGWTSYPDEPFIISYERQSEEAKRNLEEVIYGKIVLSL
SEQGFSADLFTRIKDFTKTVAVVPVSAKTGEGIPDLLAVLAGLTQQYLKKRLQYAEGPAK
GSILEVKEIPGLGTVVDAIIYDGVIKEGDTIVLNGKNGPIITTVRSLLMPAPLSDMRAKG
VKFVSVPEVQAAAGVRIAASGLDDALAGSSLYVATSPDEAKEIAEKLRGEVKELIFKGDN
VGVIVKADTLGTLEALLEALRRLNVPVKSADVGNVSKNDVLEASLTAKADKSLGVILAFN
VKVLPEAEQEAARSGVKIFSDNIIYHLLDQYTEWRERLKEEEINAQLNQLVRPGKFMILP
GFVFRRSDPVIVGIEVLGGVVRPGYPLISSKGREVGRVLAIKDNDKSLDVVRTGARVAIS
IEGKVMVGRQIDEGDIVYTDVPVDHAIKLLTDFRKFISDDEVIVLKEIAELKKKLGQKEY
VVVLNRLGS
Download sequence
Identical sequences D9Q2G1
WP_013267011.1.78912 gi|302348892|ref|YP_003816530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]