SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302349250|ref|YP_003816888.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302349250|ref|YP_003816888.1|
Domain Number 1 Region: 3-62,209-416
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.43e-21
Family Bacterial dinuclear zinc exopeptidases 0.003
Further Details:      
 
Weak hits

Sequence:  gi|302349250|ref|YP_003816888.1|
Domain Number - Region: 87-187
Classification Level Classification E-value
Superfamily PA domain 0.00068
Family PA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302349250|ref|YP_003816888.1|
Sequence length 565
Comment leucine aminopeptidase [Acidilobus saccharovorans 345-15]
Sequence
MVRALSSAISDHRAMRVLASLTAYNRVQGTIELVDAAKHVQEVLLEEAGDSLEVELVKFG
GTNVPDWVSSPTGWAIHEARVKVEGGQELTLESHPTLAAAHSPPGSAEAEAIVIDRYWWR
PESYSSAKGKVVVSPGDPYIVYRLAGDAGAAAVAFYSESAPPDAVPYKSLFLSRGEAANG
SLPAVSIPRSMVEPLRHGRKLSVVVDSDVRRDPGFPIVIAWLGDKDGKGPAAMAHVCHPT
PGANDNGSGSASLVEAAVALSRLIDRGQLPQPEATVRFVWVPEYTGSAVALTKTLKGQVT
QLLNFDMVGVEPGGGNGPLRVVASSLSALGQADAALQEAAEASAELLGFDSLRLVPYEGG
SDHDVASALGIPSAMLNGWPDVNYHTDVDDLDSVSRRMLRLSSLIASSSLYILAKSPPDP
MAFRSRLVSTLSRRHYLNGDQVAASLAASLMSGALGLQEASAPPEGWPPKVDTVVKVKPP
MIEGPRVIARRSLDAAIRVEELLATSGPMASTVYLREGLMLAAPERPLGEVVALLAAEYG
TASVSAERLTELVNLLADVKLLELG
Download sequence
Identical sequences D9PZ70
WP_013267369.1.78912 gi|302349250|ref|YP_003816888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]