SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331267309|ref|YP_004326939.1| from Streptococcus oralis Uo5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331267309|ref|YP_004326939.1|
Domain Number 1 Region: 9-137
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-27
Family BPHL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|331267309|ref|YP_004326939.1|
Sequence length 147
Comment hypothetical protein SOR_1952 [Streptococcus oralis Uo5]
Sequence
MAFGKFIQGLAGNFSEQNKEVLIKEYGQYLLENEEIQSGYKLIRDAIIFTNIRIIFTDKQ
GATGRKMSVKSLFLMNIVNVEMETAGAGIDDSEITITYLENVFLKAHNEHFSYHKFEFPK
KTDILPLYTYLLELAYHNRLKINGLDL
Download sequence
Identical sequences A0A139QRS7 A0A1X1HK82 E0PNQ7 F2QG30 I0Q392
gi|331267309|ref|YP_004326939.1| WP_000863911.1.13623 WP_000863911.1.40598 WP_000863911.1.59067 WP_000863911.1.71036 WP_000863911.1.92698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]