SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11498321|ref|NP_069548.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11498321|ref|NP_069548.1|
Domain Number 1 Region: 1-273
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 1.05e-126
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11498321|ref|NP_069548.1|
Sequence length 273
Comment F420-dependent methylenetetrahydromethanopterin dehydrogenase [Archaeoglobus fulgidus DSM 4304]
Sequence
MVVKVGVLKMGAIGTALLVEYLLDERADREDIEVRVVTSGAKMQPEEAVVAEKLKEFDPD
VVIVVSPNAALPGPKAAREAFEGKPVIVISDAPAKKAKDELKEKGFGYILINADSMIGAR
REFLDPTEMALFNADVVKVLAATGAFRLVQEAIDKVIEDIKAGKQPELPQIVVTAEKAVE
AGKFSNPYAKAKAMAAFYIAEKVADIDVKGCFIEKDPEKYIPLVASAHEMMRIAAILADQ
AREIEKSNDTVFRNPHAKDGKILGKTQLMAKPE
Download sequence
Identical sequences A0A075WJ58 O29544
224325.AF0714 WP_010878217.1.27515 WP_010878217.1.34637 WP_010878217.1.46508 gi|11498321|ref|NP_069548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]