SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11498345|ref|NP_069572.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11498345|ref|NP_069572.1|
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Vng1086c-like 7.32e-24
Family Vng1086c-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|11498345|ref|NP_069572.1|
Sequence length 93
Comment hypothetical protein AF0738 [Archaeoglobus fulgidus DSM 4304]
Sequence
MHKEEIILLHLTLYNIKKLFENAGIANGHFKAYDELGVQPVHIHKSKTEHKKAISLLCKG
ISEIFRERSPEDLIESENLKFVIESIAPELCEP
Download sequence
Identical sequences A0A075WEU4 A0A101E185 O29520
GR93 224325.AF0738 WP_010878241.1.27515 WP_010878241.1.34637 WP_010878241.1.46508 gi|11498345|ref|NP_069572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]