SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11498517|ref|NP_069745.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|11498517|ref|NP_069745.1|
Domain Number - Region: 353-473
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00963
Family Cellulose-binding domain family III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11498517|ref|NP_069745.1|
Sequence length 565
Comment hypothetical protein AF0912 [Archaeoglobus fulgidus DSM 4304]
Sequence
MRWLATFVALLIAISSVSAAEVHIFVDKESVNLGDQIRFQVYFEVNRSADIAVVGDGGDG
ALLCHVDEGEDLYEKCGEEWVFRIPEDWQEGTYRLKVVIDDTEPEEHSEEFKVVKPKIKE
FELKNLVYQSRTELEVLVESANPASLKLRLYGNNVDLYYEETADYEEESNVYSAKFDLNL
REVYERTRDIADAVKPGKYILDLKLEYGGKVWDSRRVTVSVVKPEVAVSAPEKVKVGEPV
VVSIDTNRVGDTEYDGILVVLEGNNFLLYKKAYLDENGKAKVQFETAGLREGKYAIYVRD
TSKTSTLSISDLAKNYYDLPPDNSFSRIIQAEDDVLVKKELWIVGNGKESVKVILQPSKA
EIFNGTTMSFKVLLNQSVELSSFEFVIFVSGNSVKIESVTLPDGFRLLDKTLYPDYLKIS
AYTTNKTKTGFLAEVKVAAQSPGESRLLIKNAGVYNGLGEFVDVTTSQADVVVKESRKEG
NTANVSITLKENATGAENVTNNSVTATTPPAKASQQTPAPATPPVSMNVGEIDFTKVFMF
TAGFLATYSAGRIMMRKLSARGGKR
Download sequence
Identical sequences O29350
gi|11498517|ref|NP_069745.1| 224325.AF0912 WP_010878412.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]