SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11498624|ref|NP_069852.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|11498624|ref|NP_069852.1|
Domain Number - Region: 38-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0523
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11498624|ref|NP_069852.1|
Sequence length 459
Comment hypothetical protein AF1019 [Archaeoglobus fulgidus DSM 4304]
Sequence
MQKVLLVLAVLLLAVEAVHAEGVSVSYQISPEILLPGDYADVTLTLTNPSASDVKVNSIV
VSGAKAEPSAIYSVGTIPGGGSYSITFSVKAEKVGRENLEVKIATEYRVDEKNTTTQTIT
QNILLLVDDNFPSLTVASPVYRGVVNEVSFYVSSPVELKDVRVEALFDAIPKTVYLGDFV
GGKEGKIKFIPDSNRLKFKISFYNGRNYHEIEKEVVVKLLTPQNVVLNVTFPYKSLFIGD
AVTIPLEITNLRSDAIYDITVSAESSLGSFSSPVSIAKLDSGEGKALSFKFSPSKAGDGE
AVFRVYYKDELGNGLSVERNFTITVLDSYAVMLTNVNVVREKLKYSVSGDVSNNGRSEVY
NAYAVAECGDFRADYFMGNIDPSDFQSFELPVECNGSVKVTVQWSNEIGETFAISKTVEL
KGKSLAEVEENPMPTYVSIAVAIVILAIVGFVIYRQIRK
Download sequence
Identical sequences A0A075WJX9 O29243
gi|11498624|ref|NP_069852.1| 224325.AF1019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]