SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11498789|ref|NP_070018.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11498789|ref|NP_070018.1|
Domain Number 1 Region: 3-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000975
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11498789|ref|NP_070018.1|
Sequence length 63
Comment hypothetical protein AF1189 [Archaeoglobus fulgidus DSM 4304]
Sequence
MPECPYCGRWFKTKRGLNQHIAKSHETKFGGVRVLDPTTIDPLGAAERRAERKKKRKKGF
GLW
Download sequence
Identical sequences A0A101DCW7 O29078
gi|11498789|ref|NP_070018.1| WP_010878685.1.46508 224325.AF1189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]