SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11498993|ref|NP_070227.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11498993|ref|NP_070227.1|
Domain Number 1 Region: 570-716
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.83e-26
Family Terpene synthases 0.0048
Further Details:      
 
Domain Number 2 Region: 234-319
Classification Level Classification E-value
Superfamily PKD domain 1.19e-23
Family PKD domain 0.002
Further Details:      
 
Domain Number 3 Region: 457-605
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000000000136
Family Terpene synthases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11498993|ref|NP_070227.1|
Sequence length 806
Comment hypothetical protein AF1398 [Archaeoglobus fulgidus DSM 4304]
Sequence
MRLLAALFILLILTPASALTLDVSGGCVDKPVEVVTDKEATIVFRMNSGTPVFAEVSPSN
PAYFKPRVPGELVVIAMAGDEQVTKTLQVTTCSSGSSGGGGTTSKQYLPYGTFEVLGKEV
EWRTAYGALKKASEIMGFSITPELTDWGIFVKCVRDLCKGDIGETSGWMYWVNYPNEPLP
GVAATEKRVYPGDRIVWYFSRSMSDTPDSSPFKIYIDIGDSYEITVSIIWPSKIPPVADF
TFSPANPVAGEEVVFNASKSVDDGQITDYIWNFGDGKSGRGVSVTHIYSEPGTYEVSLTV
FDNDALSDTITKAVNVSEPGIHLNLTGQVITIQPGKTKVIPSEQLMTNLSITGLTFESEK
PVQVVIAESHIPPGVVYGTFYRWFEITANDSLKATIDFRVPKDVAEGREVVLMKYNGSWF
ELPTEKTGKDENYLYYSAETESLSVIAITIKWDSFPLNVTDARIQKALDWLRTIQNDDGG
FANPGENSSISATAWAIMAIVAAGQDPHEWVKNGKSPIDFVRERLKDEMGTMGAEDYART
ILALVYANENPRNFAGVDLVGKLKSYMKENGQIGDFTYKTIWGIIALASVGENTTASAEW
LKAQQDVDGGFAWSAGEESDFDDTAAAIEALIAAEEPRDSDVIKKALDYLKTGQNDDGGM
RYFGSSASNAASDAWTIQALVAAGVNPMEWAKNNTSVVEHLLSLQTEDGYFKYTKYQTSN
PGFMTVSAIIALLGKPHPIKVNASVATAPAITATTTTTATASTTTTTTTATTTTTAAAER
KSTPGFSSAAAIAALALTAALLRRKT
Download sequence
Identical sequences O28874
WP_010878895.1.34637 WP_010878895.1.46508 gi|11498993|ref|NP_070227.1| 224325.AF1398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]