SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11499021|ref|NP_070255.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499021|ref|NP_070255.1|
Domain Number 1 Region: 7-246
Classification Level Classification E-value
Superfamily Aquaporin-like 2.71e-86
Family SCOPe 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11499021|ref|NP_070255.1|
Sequence length 246
Comment glycerol uptake facilitator, MIP channel (glpF) [Archaeoglobus fulgidus DSM 4304]
Sequence
MTMTLAKRFTAEVVGTFILVFFGPGAAVITLMIANGADKPNEFNIGIGALGGLGDWFAIG
MAFALAIAAVIYSLGRISGAHINPAVTIALWSIGRFPGREVVPYIVAQFIGAALGSLLFL
ACVGPAAATVGGLGATAPFPGIGYGQAILTEAIGTFLLMLVIMGVAVDERAPPGFAGLVI
GLTVGGIITTIGNITGSSLNPARTFGPYLGDSLMGINLWQYFPIYVIGPIVGAVAAAWLY
NYLAKE
Download sequence
Identical sequences O28846
gi|11499021|ref|NP_070255.1| 224325.AF1426 3ne2_A 3ne2_B 3ne2_C 3ne2_D 3ne2_E 3ne2_F 3ne2_G 3ne2_H 000401062|e3ne2C1|5048.1.1.2|C:1-246 cath|current|3ne2A00/2-245 cath|current|3ne2B00/2-245 cath|current|3ne2C00/1-246 cath|current|3ne2D00/2-245 cath|current|3ne2E00/1-245 cath|current|3ne2F00/2-245 cath|current|3ne2G00/2-245 cath|current|3ne2H00/2-245 d3ne2c_ GO.11583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]