SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11499063|ref|NP_070297.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499063|ref|NP_070297.1|
Domain Number 1 Region: 36-108
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000392
Family Transglutaminase, two C-terminal domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11499063|ref|NP_070297.1|
Sequence length 489
Comment hypothetical protein AF1468 [Archaeoglobus fulgidus DSM 4304]
Sequence
MRGIWIAGLVMLLLIVPSVAEENSSIAIQNLNVEPQRLFVGDSAIVTVTLYNPLESAVKV
SSVSVLGSGISYDSFELGYIPPKSTHTFSFAVKAVKEGVHNVEVAFYTESGAVRSYFTLF
VENRMPEIAFSENVKVGEVNNLSLIISSPVEIENVVIDPLFESEPDRIILSSVSGTAEVP
IRFFGERSDYEFRVSFYSGNNYHSYTAKLTPAFEEGSELAVSVSVPQSSAFLYDVVEISA
TITNLKDDAVSAIKFSASSNNGKVLLSTDEIAELESGESSEVTLLYSPERSGRDVITLAI
SYKDGMGKERTLEKAVNIDVQDSSAVDVSGVEIEAKATSSASAPPRGMFGPTSSSVSTRV
EITVSGEVVNRGFSYAKNVLVYLDFGSDTEEYFVGEVEPSDSDSFSIPASGSERSVKVVV
EWTNELGEVHSISKSYQLNPITVSTTSPPQRQSLLTPLNLAAVAIAAVGGVLVFRKWRSR
RKNESNRAG
Download sequence
Identical sequences O28804
WP_010878965.1.46508 gi|11499063|ref|NP_070297.1| 224325.AF1468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]