SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11499633|ref|NP_070875.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499633|ref|NP_070875.1|
Domain Number 1 Region: 16-189
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.29e-39
Family RNA methyltransferase FtsJ 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|11499633|ref|NP_070875.1|
Sequence length 191
Comment cell division protein FtsJ [Archaeoglobus fulgidus DSM 4304]
Sequence
MKDRQDYYYWKAKKEGYRSRAAYKLLQMNRTFKLIREGDLVLDLGATPGGWSQVAALLGA
RVVAVDINPMKPLENVTFIRGDITLPETLEKIREISPDYDVVMSDASPKISGKWTIDHLR
SIDLARASFSIAKEVLKPGGNFVVKVFQGEEIQKFFNELKPHFRFKKFHSPQASRKRSAE
VYFIGKRFRKI
Download sequence
Identical sequences A0A075WGD2 A0A117KLW9 O28228
gi|11499633|ref|NP_070875.1| WP_010879543.1.27515 WP_010879543.1.34637 WP_010879543.1.46508 224325.AF2051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]