SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000117-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AGAP000117-PA
Domain Number - Region: 208-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000183
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 273-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 304-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000466
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 241-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 340-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00264
Family EGF-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000117-PA   Gene: AGAP000117   Transcript: AGAP000117-RA
Sequence length 383
Comment pep:novel chromosome:AgamP3:X:1931524:1935351:1 gene:AGAP000117 transcript:AGAP000117-RA
Sequence
MIDTATGQAHQQALLLLVALVCTLLLPVVQTRQEYYYTYQDPYEDDLSLWINEQQVKIFS
GVAMKIYAIDNGRVSPHIRDPNFSQYLPVIPSEVSSVNFTWKAGSKKYYYNFDRLMSVDE
SILKPPTISIKTSGRVPKNAKEFSVILPCSGNVSGIAMFSIGLLIQTRKGKPVPGTPLRI
KLRKECAHRGVYERSSTLTSSSQGPDPECDKKCANKGVCNEDKICQCPEGYMGQYCQTAL
CYPQCMNGGNCTAPGTCSCPPGYQGRHCEGGICAEKCQNGGKCIQKDKCECTKGYYGLRC
EYSKCVIPCLHDGKCRGVNKCRCKPGLSGDHCQIGRRQRSTCKRPCKHGLCQPNHTCACD
SGWYGRLCNQRKYAPRPNSGTAS
Download sequence
Identical sequences Q7QER8
XP_311028.4.40869 7165.AGAP000117-PA AGAP000117-PA AGAP000117-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]