SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000153-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000153-PA
Domain Number 1 Region: 428-557
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-23
Family Cadherin 0.00068
Further Details:      
 
Domain Number 2 Region: 542-616,649-675
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000102
Family Cadherin 0.0081
Further Details:      
 
Domain Number 3 Region: 319-440
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000314
Family Cadherin 0.013
Further Details:      
 
Weak hits

Sequence:  AGAP000153-PA
Domain Number - Region: 192-290
Classification Level Classification E-value
Superfamily Cadherin-like 0.00288
Family Cadherin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000153-PA   Gene: AGAP000153   Transcript: AGAP000153-RA
Sequence length 1803
Comment pep:novel chromosome:AgamP3:X:2466406:2477593:1 gene:AGAP000153 transcript:AGAP000153-RA
Sequence
LTLALLALAACWPEAAGLDPKFDPSTRMGLVLVPADATVGSVIYRLRASDEEFEYPLQFE
LVGDASSSTVQIETLPCTKFNSICQANVILTRRLEPGRYYDFQVSVKDTKGGMSVQSCSI
TATNFTTPHDVIFPHKAGIIMVPEDAKKGTELDYVLANKNPLFQKPVYLELWDAYAEPGQ
DTRNIAGLEVVIIVEDVQDVPPVFTVAPPVTRLPAGLIPGDKDGDKGVPREIRYGLVSEG
NPFTSFFDINETICVSRFYCSPGEISLLRPLDDILALTHAGDPVLLTVIAEEVKVSRDEP
PAMATTVQLAFFLPERSNSPPYFENDHYVARLDENAAPGTVLTFTDPYTPRVMDDDAGKN
GVFSLTLLGNNGTFEISPNVAEGHANFVVRVRDSARLDYEAATYVHFQILAQELGPATNL
SMLVNVTVYLADVNDNPPVFEQADYIVDLPENMTAGTRVVQVHATDVDTARLGGRVRYTQ
ILGPHNTSLNLDPASGVVTVALNNHGFDREAMPEYHLYVEARDDDGIGNRAQVPLVIRLI
DVNDETPAFEKPLYEFILAADLRNFTVPAFIRATDGDAEAPNNEVRYELIYGNYENKFFL
HPITGELKLNGPLVPRTGGGGQSVGGLRRRRQTGGSVASGGPPATGQKESDVFVLTARAF
DLGVPVRYSTATIRVYPPESRTRTVTFIVPGSDPDRKKVQDTLADITGGRVIIQEVRPYR
TGDGGIPTDLIGGGGGSGGGAERSVVIATILYDADSVVDIAKIQQRLSINGTVTNIISQE
ERSAVSILYKAENRVLFWLLIFLAILLALGILTLLLCCICPRCPLNATNRKRILRVNNIE
DDLAHRKQGLGKQSKSVQVAEWMGRREAWSAANRSTDSRTKPTHWEYRGRRDIGKGTLAA
AGDDGGDDRDGEPDQRGDESGTDGNERKRANDGGKLEKHTVKISTNQAPLFVRCRSDMKS
KSTKDDTHMHRSRTNLLNADRDMYVEDVDEHDPEYQSLKRIHHHHHHHHAGGGGGGGGGG
GGGGKPTTDDALPIDDDSMRRHEMDRGSDLNYERRGSFKRQGHAVSLPQYIMVDNGGKEI
LMRRYIEEQANGKQIIREHYQLLPGTTFIQTIPNEVPVRRGEHVTEVKIGAGAGRSKDPA
ADGDGDPGRLKPAVSTHSLMHQELEHSLKQQNALLRQILLEKEKLEERYNQYEQALETQS
LPCQSMAVVVAATQTDCDTGTQTEPMRGGGGGGGAGGFGASGGFGRRRTKSENDDSLSED
EYEYVRYSPPDSPDGVGEYSGGESTGERKSNRRIIVVESVKRKIRTPIQEEEDELHHGRE
LRREGPGGGGHRRGGQETRTSILRRKRNEELSRNGKEPGKEQRLKRDVLMEISDSLHGPE
QRGRRGGGNGGNGAPGADGRRKKVYRKNVKYYEDSDGSEKEVVVQKNYFSADSLDEMASD
VEDYRYSVTKTSKSVTVSPKASVEQRVSRRDDKTETTTTRIRLTTSESPSRRQAAGTGGS
GAMAGSQGPKGPAPKPPRLSKSVSKEEDLNEPGGGGGGGGGGEGQQHGVNPKYMDWYYNL
SKEGDSLEKRDGRKRDREPAGGTTLLTTTTTSSTTTITTGGSRRKGEGEAAAAPPAKGKP
EPAPRTSPPKEARLLKEDIQHARKVTQSQQQQQQQQEAGGSHPLLQHSEHRFEAEYGTGP
PVVPAPPDKLPHYLYPETPPIVSRDNKVQIKIVDQSAAATAAPGAKSNGAGGGGGGGTST
KNAKTLNVSTLEDDHDSGIAMNSLLHTKGKRNKIADKKSIFTIAYDDVRIRQIRSESDTP
PFS
Download sequence
Identical sequences 7165.AGAP000153-PA AGAP000153-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]