SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000224-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000224-PA
Domain Number 1 Region: 253-347
Classification Level Classification E-value
Superfamily TIMP-like 7.46e-16
Family Netrin-like domain (NTR/C345C module) 0.025
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 67-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000224-PA   Gene: AGAP000224   Transcript: AGAP000224-RA
Sequence length 352
Comment pep:novel chromosome:AgamP3:X:4180964:4207629:-1 gene:AGAP000224 transcript:AGAP000224-RA
Sequence
MPACNCNGHARRCRFNMELYKMSGRISGGVCLSCRHATTGRHCHYCREGFYRDATKPITH
RKVCKACDCHPIGSSGKTCNHTTGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKIPRV
INMVHSQNTAPEESHQYAVSSGGGGQHEPEAPTYRMHAGRECGKCKISTKRLNLNKFCKR
DYGKVGSFIGKFNLQKQIKTRCQMQINTPSEARKQVDTKPSDSGTGKGSTGSGNPSQPYQ
PPPPRYRGTPPEDGAVRFHLSVQKVFKRSRSPASPLAKASKWSDVPYIVSAHDLDCRCPK
LKVHRSYLILGNESEGPAGTLGVGPRTILIEWRDEWHRRLRKFQRQADRTCH
Download sequence
Identical sequences 7165.AGAP000224-PA AGAP000224-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]