SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP000461-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000461-PA
Domain Number 1 Region: 886-1148,1267-1302
Classification Level Classification E-value
Superfamily NHL repeat 5.49e-22
Family NHL repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 300-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.056
Further Details:      
 
Weak hits

Sequence:  AGAP000461-PA
Domain Number - Region: 551-622
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000114
Family Pre-dockerin domain 0.075
Further Details:      
 
Domain Number - Region: 371-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000147
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 269-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0003
Family EGF-type module 0.07
Further Details:      
 
Domain Number - Region: 205-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 401-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 429-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00314
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 234-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0133
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 1304-1491,1669-1732
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0377
Family Quinohemoprotein amine dehydrogenase B chain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000461-PA   Gene: AGAP000461   Transcript: AGAP000461-RA
Sequence length 2581
Comment pep:novel chromosome:AgamP3:X:7976922:8000233:-1 gene:AGAP000461 transcript:AGAP000461-RA
Sequence
IVELREFNEVHASTIAPFQFWNVEFRNKHPAFIQFNFTLPWGANFAIYGRRNVGPTVTQY
DFVEFIKGGRVDHKLRRKRSIGGGGFFQNDLLGAHFDGSVPEENSSAFETIRHNQYAFAD
LPLDEVEKHIISKRSADGGAAGPGGPSSSLQKIDLEAMTVNVTILQYLDIGRWYLSVYND
ELLPHTVSLVVGEAEGVHTACPSDCSGRGSCYLGKCDCIDGYQGNDCSISVCPVLCSAHG
HYGGGVCHCEEGWKGSECDIPVSECEMPTCSNHGRCIEGDCHCERGWKGLFCEQQDCIDH
SCSGHGTCVSGQCFCKAGWQGDDCSIVDQQVYQCLPGCSDHGTYDLDTGSCICDRHWTGI
DCSQAVCSLDCGPNGICENGRCRCDDGWTGSLCDQLMCDPRCAEHGQCKNGTCVCSQGWN
GRHCTLPGCVNGCSRHGQCTMEDGEYKCICVEGWAGNDCSIALEMSCKDNIDNDNDGMTD
CSDSECCVHSICAEHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLIEENSVQSYAHMD
EYSESRVSVMRGQVVTPQGLGIIGIRVSVDRDSRFGFTLTRQGGWFDVLVNGGGAVTLQF
QRSPFRPLTRTVFVPWNQIVVLPPVQMQINDNDEHDDISFISVPSNLAYSFLSTSHYRFL
EDNPSPIAICLEHDHELLSPHLTSTWMPNGIGSVPGKNFIFAETQVVQESLKIPGSEIHL
LYKSSQASGYRSIVRMQLTHDRIPDTLTHVHVGVQIEGSLHVKTYEADPNLRHIFAWNKR
NVFKQKVYGIAMARISIGYEHATCRGIVWETRTVKLQGFDVDISDIGGWGLDIHHHYNFH
EGILQKGDGATIHLKEFPRIVRGVLGDGQQRTLMCRDHCNGLSKNGQLLTPVALASGPDG
SLFVGDFNLIRRITTNGSIFTILQLDTTRVSYQYYLSVSPADGQLYISDSEKHKILKIVS
LENVEDPSSNYDVIVGSGQRCIPGDEQNCGDGGPAIEARLSHPKGLAIAADRTMYIADGT
NIRAVDPKGTIHTLIGHHGHQNRWSPVPCRGAARAMQVQLQWPTALALNPLDGSLYFVDD
RLVLKLTSDMKVKVIAGIPLHCNEDHLAGMNRTAPAEEPLGTVLAMAFGPNGDLYVADTN
SKRINTIKVIESSTGFMKQFAGKIDHGRGMRIPHSLYSFLKHTNFSHFSPRFSPKTAKSA
TVRVKRSTTPDASANGTNGGQSPSSTDRGAVGPDGSGGPFCVCQHANDTASGRKEYPDTA
SAFGTASNGGAAGETILSSNIRFQSISAIAVAQDGVINVADQGESRNGVGIVLANVKSNL
IFPSHRSGSLRIFALEHYLPQHDSNGEFQIPYTPLNELYVFNRYGQHIATRDLSTGKSRY
SFLYSKNTSFGKLSTVTDSSGNKIQFLRDYSNVVSSIENGQDYKTELKISPSGLLTKVSA
RSGGGRKVEVLLDYESNSGLLISRTEGQESFIYQYDDFGRCVKVIAPSGEIVHVHTLFDD
RSTKPKQEDLLVSVQSSIRSAFGARGASKPTEYSITGGIQTVSIARGGKETVGRIGSINQ
TVSLSLPAGIRLEASAVATHPWLERFLPTEAEMLPMWSHQSLHVGDRAANDLYSSYALTI
RSQREILRDRDNEVILVVSYDQSGLPTMFSPGAGDVYYPLNITYDRFNRIEGWQWGPSEL
KYNYDRQGRLAEVSSLQDGIVSYSYNEGNLLEMISLGSQRKYKLVYDRNGGLREIVLPSG
TKHTFSLQPSIGFLRFTYNPPGSSRSYLQHYSHSGVLLQTVFPGDGARIVYRYDDEDRIS
EIVHGDGRDEFLYQSGAPACELPMAIIHTERDLEFRWDFDCVGELLLEERIDFSARSGLS
NVKFNYEYDDHFRLASIGGRIGGQNLPQQSFGYDERTGRLATIGQFEVMRGGDRQINATT
VSDRTGTFMRTVNGRFLLMQLTLTIHRMEVFRMEFAHDLHGRIVQTRTYTRNVGVNTYTN
VKNFTWDCDGQLVGVEAQEPWGFRYDDNGNMLSLTYRGNTIPMEYNAQDRIVKFGEGQYK
YEPRGLVAQNAREERFHYNAKGLLIRATKRGRFDIRYFYDHLNRLITRKDNFGNVTQFFY
TNQRRHSEISHIYSPRDGKLMSLTYDDRGSLIYAQVYRYRYYIATDQCGTPVMIFNQYGE
GIREIMRSPYGHIVYDSNPYLYMPIDFCGGILDQVTSLVHMPDGKVYDPLIGQWMTPHWE
HVDQRIRKPTKLHLYRYNGNDPINPPRQLQDHPRDHLDWLQLMGYDLDNMIPQASIASRF
YQQRSWLENALASPNVLRRQYEERGGSGGINIGSGFMAHLMERSVRTRQDLLQLPDSFFG
SSLKSDPLAIGPFRLGSGSDPPFGHGIIVSRVVADEPEGGYAIVSSVPAANPIYRDVYTS
VFNRTRLLPFTFVVHNSLQDAFFFVKEDSWRAAEDRQQLKRLQGQVNTTFHDPVSAGGPG
GPGGPGADRSPGGGAKPSAHQDVKIHTTNAIINLKYGTTSAKERQRLMHHAKLQAVRKAW
HREKELLRSGLISSYEWNAQEMEEIIKNGYANLYEGEYVHDIDRYPELLEDPFNVRFTKK
K
Download sequence
Identical sequences 7165.AGAP000461-PA AGAP000461-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]