SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP001016-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP001016-PA
Domain Number 1 Region: 26-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000907
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  AGAP001016-PA
Domain Number - Region: 9-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP001016-PA   Gene: AGAP001016   Transcript: AGAP001016-RA
Sequence length 139
Comment pep:novel chromosome:AgamP3:X:19514136:19516431:-1 gene:AGAP001016 transcript:AGAP001016-RA
Sequence
MVSNLPALQSCMCEPGYTGKNCESGYIPCSPSPCQNGGTCKQSTKYSYECKCPPGTSILL
HRVNPAEAPAGRRAINNQTITFIINNQPEGLPRTANSCFNQRTIGLSSTTKTVMMVSCVL
NALFNMIEKQSGSNSGVVL
Download sequence
Identical sequences AGAP001016-PA 7165.AGAP001016-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]