SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP001381-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP001381-PA
Domain Number 1 Region: 799-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000893
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 2 Region: 315-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 954-1001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 4 Region: 845-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.0034
Further Details:      
 
Domain Number 5 Region: 905-956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 6 Region: 1006-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 1057-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000206
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 489-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 252-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 10 Region: 751-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 402-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 12 Region: 438-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 1105-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  AGAP001381-PA
Domain Number - Region: 1429-1537
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00217
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 91-147
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00702
Family beta-mannanase CBM 0.081
Further Details:      
 
Domain Number - Region: 1548-1661
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0392
Family Chemotaxis phosphatase CheZ 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP001381-PA   Gene: AGAP001381   Transcript: AGAP001381-RA
Sequence length 1750
Comment pep:novel chromosome:AgamP3:2R:4053093:4060198:-1 gene:AGAP001381 transcript:AGAP001381-RA
Sequence
VASRPPIHRVHPCEQSSCYPATGNLLIGRENRLEASSTCGTVRPERYCIVSHLEEKKCFL
CDTRRETENDPMRNHRIGQIIYKMQPGTVEQTWWQSENGRENVTIQLDLEAEFHFTHLII
VFATFRPAAMLIERSYDFGKTWHVYKYFAHSCRESFPHAPLVARNITDVICDHRYSGVEP
SKNGEVIYRVLPPNMNIENPYAEHVQNMLKMTNLRVNFTKLHSLGDNLLDDRDEIQEKYY
YAISNMIVRGSCSCYGHASRCLPLEGVRNTVDMVHGRCECTHNTKGLNCEECEDFFNDLP
WKPALGKQTNACKKCNCNNHATSCHFDQAVYEHSGRVSGGVCDNCQHNTQGYHCEECAPF
FYRDPNEDIQSPYVCKPCDCDPRGSLDDGICDSIADEENGIVAGACHCKRNVNGRRCDHC
REGFWNFDEHNPDGCQPCTCNTLGTVNNSGCNVYTGECICKRLVTGRDCNQCMPETYGLS
DSLEGCTPCSCHPGGSLDNSCDVITGQCRCRPHMQGRDCSEPKQHYFIPTLHRILEAEVP
STVSESEQNCSVVVRERANDRDADFTGPGFIRASEGTVLKFTVDDIPKTMNYDVMVRYQP
QMKGDWENVRMTVIRPEVYDPEGPCANSHPSYERDITTTLSEYETSAIALHDICLESGKT
YKFIVSFQRHEPYDDNPTAQILIDSIVLIPRIEITPIMQGSHQAEVRHREYVNLGCNHTY
YDVNYILNAPEECKDLLKTISVYINNGAMPCECNPTGSKSKKCAESGGFCTCKTNVVGRQ
CDRCAPGTYGFGPEGCKACDCNSIGSKDNDCDLITGQCNCHPNTYGRECDQCQPGFWNFP
NCQICECNGHTPTCNSKTGECLHCQDFTQGWKCDRCVDGYYGNPLLGSSIGCRPCRCPDT
VASGHSYANECYLHPSTNDVICSCEEGYSGARCDVCADNYYGNPEKPGGQCQSCDCSNNV
DPKRPGNCDSKSGKCLQCLYNTEGDHCEYCRDGFYGDALRQDCRACDCNLLGTNQTIQHC
DRYTGQCPCLRNVKGQYCDECIENHWKIASGEGCEACDCDPVGALSEQCNPYDGQCSCKP
GFGGRQCNQCEAYFWGDPNVECKPCECNAYGSATQQCDRTTGKCACKSGIGGYKCDQCDR
GYLGQAPYCEPCGECFDNWDMILDGLRNETDRTIEEAKTIKKLGATGAYKKEFDSMSKKI
AQIEGLLNNTISDREIEAIGGEIDRIRNHLQESLHNLEESERKLQETDSNIKLANIEIVN
LGRRADDVKQMTNYLKDNATKLQEGNIEGALNLTRDAWYRVSMLGETNMNITAINSRAEN
YCRRAEHLINKNQADVVRNHENNEAAFLKYQEELNDLNGNMPDLNQRICDRHGDPCDEFC
GGAGCKNGCGGLRCENGALTLSEKALDFAKKTEQNIKEKEELADDILRSMSQAKANASES
YKKAKRTHDETQAHLEDTKDLIDRANILVVKLTDMIENTTASPGEMRELIEQVMSYTLQL
DPEQIDDLAQKIQDAVSHLVNVESIIRNTENDLRRVEMLKSDALDKKERAEKVLAGVLNI
TRALDDADDAQKKARQSIKQANADIASAKIDLEEIDKETEEAQKRANSTANAVLALQSRL
EQLQKDNIRNELDAKDINKQAEDVKDSANNAHERATQLKNDFKTANESLTAQARRSESAR
ERAQNLLNRASKITVDTTTQLSALQSMDDIYKSNEKEIQNLEAELNDLTGKITFYLQTIQ
TNAERYRQCT
Download sequence
Identical sequences 7165.AGAP001381-PA AGAP001381-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]