SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP001591-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP001591-PA
Domain Number 1 Region: 501-636
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-27
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 1265-1404
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 949-1051
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 617-733
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-21
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 1053-1162
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 267-416
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-20
Family Cadherin 0.0037
Further Details:      
 
Domain Number 7 Region: 164-279
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 8 Region: 733-833
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-17
Family Cadherin 0.0027
Further Details:      
 
Domain Number 9 Region: 1496-1618
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000571
Family Cadherin 0.0038
Further Details:      
 
Domain Number 10 Region: 1158-1281
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000327
Family Cadherin 0.0064
Further Details:      
 
Domain Number 11 Region: 390-505
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000414
Family Cadherin 0.0039
Further Details:      
 
Domain Number 12 Region: 1380-1476
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000785
Family Cadherin 0.0043
Further Details:      
 
Domain Number 13 Region: 843-955
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000113
Family Cadherin 0.0065
Further Details:      
 
Domain Number 14 Region: 71-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000109
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP001591-PA   Gene: AGAP001591   Transcript: AGAP001591-RA
Sequence length 1880
Comment pep:known chromosome:AgamP3:2R:6519174:6525698:1 gene:AGAP001591 transcript:AGAP001591-RA
Sequence
MEQNRSTDKLQMEILKRTVCRLKPSAHRCLLAGSHSFTQLVLCLILSATLVSCNRAPVFL
IDDHAEIVIRLREFPETPVGTLIYRLRGYDADGDPLTFGVQKSADSHIIRLKQNTSSEAF
VYLNHELDREAREEYTLILTLTDGRLGEGNFVTQSFLLLVEDINDNEPIFKPFASVLEVA
EDSPPGILTTLEAVDKDEGAYGQVVYYIQGLSEENNVFSISTSNGKGVVRLARALDYERQ
HFYHINVLAVDRAIQGRINTGTAALLVRVKDVEDQPPEFLVTQPVVRISEDAPIGTEVAS
MIYSLSTVKAVDGDRGINNRIIYGISNNGSELFEIDRLKGSLRTKQKLDREDSTNPINGA
FILEVVAIEESKLQPAPSSTMEITVIVTDVNDEIPRFRSDGYECEIGENAQENTLARFID
GSINEVFDYDQGKNGTFRLSLHPPSDIFEVIPKRAINEATFGLRVKDPSMLDYERVRELS
LTVVASEVESAGRTSTAQIRVVVLDQNDNFPEFSQPVYEIDVPENVTAGTVLLQLQATDS
DSGLFGTEGVRYANLTGSISSFLHLDPHAGTVTLMASESPVFDREIIQKHYLSVEARDNG
GRGNRNTVPLILNVLDVNDNAPVFVQKRYEVRLKENAFEFESPIVVEARDSDLEGSPNSA
VEYRLIGAHHSDYFHVDRRTGRLSVREAVDFERLESSGGSGDTRTIALTIEAADGGEPPL
TAQVEVTVYVQDVNDYAPVFLESQYAIVIPEDTPSGLPVLRVTAMDGDGSFPNNHVTYRI
QQGGDGRFVIGASTGEISITHGASLDPNLLAPDALGSGSTYVLEVFATDGGNGDQQLQGS
CLVNNTPVGTEVYRLMATDPDEGAMLRYYIDRSLSEGKTEEGALVKLDDYDFAAAFILNE
TNGLLKIAKLLDREKIAEIKLACVVEDVAAERGDQMANTFLKITVLDENDNNPKFRKPFY
KHSIAENSQYGVAVCTVVAEDADQNKTVKYSLEGEKGVLELLHVDDETGEIVVRNRIDHE
EYSWLNFSVRAADTGTPPRASFVEVFVQVLDENDNNPYFVDSVNDYYVSENASVGAEIAI
ILAKDLDSGDFGRITYILDRVSSKEKFSIDPEKGILRVAGALDREETAEYMLAVEAWDNY
PYGYLNGESRNAFKHILIHVLDDNDNVPVIQKPSGCSMITEYHNINDPIVKLRATDADDP
TNGNGQLSFDIVDPSGIFYIQQVSAQYAEIYSRGPLKNLHGNYTLELIVSDLGGVPNTAR
ETVDICVTDFNDHAPVFVVPSGNTTVKVFENTTLGKPFFQVHAYDEDVGENAIVRYRLKM
DTMGNFRKFSLDKETGELSLAASLDREQQMMYDLRIEAYDQGIPTPLSSTVDLIVYVRDV
NDNLPQFLLKEISLNFTEHMTPGTERIRLPDTVDQDYLDPLDGPAASVVCYYIVHGNEDG
HFGLDPVSHDLTVEKELDREKKSLYKLHIKATEECTNANLSLDTTSHSGNLLKATVYIND
INDNSPVFESKIFTGGISTSSLFGATILQLQATDEDDGLNGLVRYYRHGEVRKTLAEGLD
DLRSDPFLVEADTGQVLLNFFPQKSMRGYFDFSVLANDSYGCHDRAHVFIYLIREDQRVK
FILRQRPSEIRHNIQSFREILSNVSGCIVNIDDIRVHENPDGSVDRTKSDMFMHLVDQKN
NSVLEVHQVLQLLDTHVEKLDRLFKEFNVLDTQASELVQTAEMDELSVNIIWLFVTNILL
GALLIVVIGLSISQRLSYRRQLRAAKIAAFGSTGPSRMYQEVLGAVPNTNKHSMKGSNPI
WIGSGTPEGEWAKDEFDKCKDAIDAQYERSLSSGFFIDNCLQYEARKGFAGAEANNAANY
QLKRDSETTLCARNLETTEL
Download sequence
Identical sequences AGAP001591-PA 7165.AGAP001591-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]